(data stored in ACNUC7421 zone)

EMBL: CP000462.PE288

CP000462.PE288       Location/Qualifiers
FT   CDS             complement(334196..335110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0307"
FT                   /product="transporter, drug/metabolite exporter family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39823"
FT                   /db_xref="GOA:A0KF19"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF19"
FT                   /protein_id="ABK39823.1"
FT                   /translation="MLKDQKKAYQYGLCAVALWSTVASAFKISLAYFEPVQLLLVAACT
FT                   STLTLGVIVACQGKLPLLLGYIKSRPLYYLALGVLNPFFYYLLLFKAYDLLPAQQAQTL
FT                   NYTWAITLSLLAVPFLGQKLRRRDGVAIVLGYFGALVIATRGDVFGLQFDSPLGVTLAL
FT                   VSTLIWAGYWILNTRNQGDPIVSLLLGFLISLPFIVAATWLLSDFSMTAWQGWAGAIYV
FT                   GLFEMGFGFVLWLMALRHATNTAPISNLIFISPFASLVLLNLLIGETIHPATPIGLALI
FT                   VAALLIQQLKYGRRYRKTSEPQA"
     MLKDQKKAYQ YGLCAVALWS TVASAFKISL AYFEPVQLLL VAACTSTLTL GVIVACQGKL        60
     PLLLGYIKSR PLYYLALGVL NPFFYYLLLF KAYDLLPAQQ AQTLNYTWAI TLSLLAVPFL       120
     GQKLRRRDGV AIVLGYFGAL VIATRGDVFG LQFDSPLGVT LALVSTLIWA GYWILNTRNQ       180
     GDPIVSLLLG FLISLPFIVA ATWLLSDFSM TAWQGWAGAI YVGLFEMGFG FVLWLMALRH       240
     ATNTAPISNL IFISPFASLV LLNLLIGETI HPATPIGLAL IVAALLIQQL KYGRRYRKTS       300
     EPQA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page