(data stored in ACNUC7421 zone)

EMBL: CP000462.PE29

CP000462.PE29        Location/Qualifiers
FT   CDS             36874..38151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0033"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein DctD"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36763"
FT                   /db_xref="GOA:A0KR14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR14"
FT                   /protein_id="ABK36763.1"
FT                   /translation="MLLPANRPANVLLVDDDEDVLESYCHLLRLSGYHPRATTSPHEAL
FT                   ALLADQWPGVLVSDIYMPAMNGMDLLASVQALDAEIPVIMITGHGDIPLAVRAVKQGAF
FT                   DFLEKPLNPQDLLGLLERACRQRSAVLARRSEIQATVDDELIGSSPQIVTLRSQLNQLA
FT                   QTDKDLLLEGPAGSGRHTLARLLHRISARREQAFQLHDCVSAPSLAEVQASLAQAGQGT
FT                   LVLQSPARLSADCQRWLGNHLLDQERKGSKSLRAIGLFDESPEALVERQQLMPELYYFL
FT                   SQVRLKLPRLVERSCDIIPLFRAFLRQGCKRIGRPVPAVDRAYLETLKRHQWPGNLREL
FT                   RNVAELYAVGIVKLAGAEQVIPLASGKEPLDDLVEEFERRVIEDTLFLFSGRVTDAAQY
FT                   LGIPRKKLYLRMKKHQLDKDRFKPAT"
     MLLPANRPAN VLLVDDDEDV LESYCHLLRL SGYHPRATTS PHEALALLAD QWPGVLVSDI        60
     YMPAMNGMDL LASVQALDAE IPVIMITGHG DIPLAVRAVK QGAFDFLEKP LNPQDLLGLL       120
     ERACRQRSAV LARRSEIQAT VDDELIGSSP QIVTLRSQLN QLAQTDKDLL LEGPAGSGRH       180
     TLARLLHRIS ARREQAFQLH DCVSAPSLAE VQASLAQAGQ GTLVLQSPAR LSADCQRWLG       240
     NHLLDQERKG SKSLRAIGLF DESPEALVER QQLMPELYYF LSQVRLKLPR LVERSCDIIP       300
     LFRAFLRQGC KRIGRPVPAV DRAYLETLKR HQWPGNLREL RNVAELYAVG IVKLAGAEQV       360
     IPLASGKEPL DDLVEEFERR VIEDTLFLFS GRVTDAAQYL GIPRKKLYLR MKKHQLDKDR       420
     FKPAT                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page