(data stored in ACNUC7421 zone)

EMBL: CP000462.PE303

CP000462.PE303       Location/Qualifiers
FT   CDS             341840..342145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0322"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36422"
FT                   /db_xref="GOA:A0KF34"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF34"
FT                   /protein_id="ABK36422.1"
FT                   /translation="MAKTSMKAREAKRAKLVAKFASKRTELKAIIVDMNASEEARWDAV
FT                   LQLQQLPRDSSPSRQRNRCNITGRPHGFLRKFGLSRIKVREHAMKGEIPGLKKASW"
     MAKTSMKARE AKRAKLVAKF ASKRTELKAI IVDMNASEEA RWDAVLQLQQ LPRDSSPSRQ        60
     RNRCNITGRP HGFLRKFGLS RIKVREHAMK GEIPGLKKAS W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page