(data stored in ACNUC7421 zone)

EMBL: CP000462.PE31

CP000462.PE31        Location/Qualifiers
FT   CDS             complement(38565..39377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0035"
FT                   /product="hydrolase, Cof family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37704"
FT                   /db_xref="GOA:A0KR21"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR21"
FT                   /protein_id="ABK37704.1"
FT                   /translation="MYKVVVSDLDGTLLNGQHQISPRTRDTLHRLVDQGIKFVVATGRH
FT                   HVDVRSIRDTLGLDIYLITSNGAVVHDKQDQLIFNQALPDGVAAELIALERDPSIHINL
FT                   YYGDEWLVEEEMPWLLQFHHESGFSYRLTDLASHPLDKVNKVFYIGEHEKLLQIEAELN
FT                   QRYGDRLNVTFSLPDCLEVMHAGVHKGNAVRAVLEQHGLEMSQAVAFGDGMNDFEMLSM
FT                   VGRGVVMGNAHDRLKLALANHEQTLSSDEDGVAVYLEQLFALQGVNVA"
     MYKVVVSDLD GTLLNGQHQI SPRTRDTLHR LVDQGIKFVV ATGRHHVDVR SIRDTLGLDI        60
     YLITSNGAVV HDKQDQLIFN QALPDGVAAE LIALERDPSI HINLYYGDEW LVEEEMPWLL       120
     QFHHESGFSY RLTDLASHPL DKVNKVFYIG EHEKLLQIEA ELNQRYGDRL NVTFSLPDCL       180
     EVMHAGVHKG NAVRAVLEQH GLEMSQAVAF GDGMNDFEML SMVGRGVVMG NAHDRLKLAL       240
     ANHEQTLSSD EDGVAVYLEQ LFALQGVNVA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page