(data stored in ACNUC7421 zone)

EMBL: CP000462.PE319

CP000462.PE319       Location/Qualifiers
FT   CDS             complement(360144..360824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0343"
FT                   /product="modulator of glutathione-dependent potassium
FT                   efflux system"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39135"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF50"
FT                   /protein_id="ABK39135.1"
FT                   /translation="MITSLLNASFFRRSLASVFGPSSDQEPMKRILVIFSHPALQSSRA
FT                   NKQLLQAIDGLEGVTLHDLYQHYPNMFINVKREQALLSEHDIIVFQHPFYWYSCPAIMK
FT                   EWMDLVLEYGYAYGPEAHALNGKQWLSAITTGGAPESYCSEGYNQRPLLDFLLPFRQTA
FT                   QLCGMSWLPPFVLHSFHKIRDQEALRRCGQDYRQLLCALRDEQLTPAQLAGSPYLRDLL
FT                   EVLS"
     MITSLLNASF FRRSLASVFG PSSDQEPMKR ILVIFSHPAL QSSRANKQLL QAIDGLEGVT        60
     LHDLYQHYPN MFINVKREQA LLSEHDIIVF QHPFYWYSCP AIMKEWMDLV LEYGYAYGPE       120
     AHALNGKQWL SAITTGGAPE SYCSEGYNQR PLLDFLLPFR QTAQLCGMSW LPPFVLHSFH       180
     KIRDQEALRR CGQDYRQLLC ALRDEQLTPA QLAGSPYLRD LLEVLS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page