(data stored in ACNUC7421 zone)

EMBL: CP000462.PE32

CP000462.PE32        Location/Qualifiers
FT   CDS             complement(39471..40511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0036"
FT                   /product="lysophospholipase L2"
FT                   /EC_number="3.1.1.5"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38149"
FT                   /db_xref="GOA:A0KR22"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR22"
FT                   /protein_id="ABK38149.1"
FT                   /translation="MNLLSPALLALTLFSAGALAVNNPYQLTPEADVATLHQQTLPDFW
FT                   RQHAVESAFKGKDGITIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYSLY
FT                   LIDHRGQGLSDRLLADQEKGYVDQFDDYVLDLKQFHDEVIAQDQPAKLFLLAHSMGGAI
FT                   SARYLERWPDDIEAAVLSSPMMGINLGGLPKWLAKGLAATIGTVGGWLGEPPYGPGQGP
FT                   YESHDFADNGLSHSEARYQAFRELYEQRPQIKLGGATAHWIYQGLTGADAAVAEAGAIK
FT                   TPLLLLQAGDDGVVDNAAQDAFCALARCEGGKPLRIEGAWHELFMEADPQRQAALNATL
FT                   AFFARY"
     MNLLSPALLA LTLFSAGALA VNNPYQLTPE ADVATLHQQT LPDFWRQHAV ESAFKGKDGI        60
     TIRYAALRQA KVDRAILIVN GRVESYLKYQ ELAWDLWRQG YSLYLIDHRG QGLSDRLLAD       120
     QEKGYVDQFD DYVLDLKQFH DEVIAQDQPA KLFLLAHSMG GAISARYLER WPDDIEAAVL       180
     SSPMMGINLG GLPKWLAKGL AATIGTVGGW LGEPPYGPGQ GPYESHDFAD NGLSHSEARY       240
     QAFRELYEQR PQIKLGGATA HWIYQGLTGA DAAVAEAGAI KTPLLLLQAG DDGVVDNAAQ       300
     DAFCALARCE GGKPLRIEGA WHELFMEADP QRQAALNATL AFFARY                      346
//

If you have problems or comments...

PBIL Back to PBIL home page