(data stored in ACNUC7421 zone)

EMBL: CP000462.PE320

CP000462.PE320       Location/Qualifiers
FT   CDS             complement(360821..361717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0344"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37804"
FT                   /db_xref="GOA:A0KF51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF51"
FT                   /protein_id="ABK37804.1"
FT                   /translation="MINIVFRWLSSEKTMVGLMLDLRLLRFFIAIYEEKNITAAAERCH
FT                   VSQPSLSAGLRQLEETLGDSLFIRGKKGVAARDQAHYLYPHAVKLVEEARRLPALFRQK
FT                   ATRARLNMAIMPDLSRRRVAGLLQQVQAVLPELDLTLSDYGTPADCRLTLDALRREDEI
FT                   FLPLWEEDYVLCVRRDHPLASRQQLELAELQHYDFIECPPCEAHQQTIGLLACDRLTLN
FT                   LVAKAESKGLVMALVLAGVGISFLPDGLVEDEAGLCTVPVRGPRMFRRIGLCYPAHQTL
FT                   NPALRELIPELASHGAS"
     MINIVFRWLS SEKTMVGLML DLRLLRFFIA IYEEKNITAA AERCHVSQPS LSAGLRQLEE        60
     TLGDSLFIRG KKGVAARDQA HYLYPHAVKL VEEARRLPAL FRQKATRARL NMAIMPDLSR       120
     RRVAGLLQQV QAVLPELDLT LSDYGTPADC RLTLDALRRE DEIFLPLWEE DYVLCVRRDH       180
     PLASRQQLEL AELQHYDFIE CPPCEAHQQT IGLLACDRLT LNLVAKAESK GLVMALVLAG       240
     VGISFLPDGL VEDEAGLCTV PVRGPRMFRR IGLCYPAHQT LNPALRELIP ELASHGAS         298
//

If you have problems or comments...

PBIL Back to PBIL home page