(data stored in ACNUC7421 zone)

EMBL: CP000462.PE322

CP000462.PE322       Location/Qualifiers
FT   CDS             362617..362940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36987"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF53"
FT                   /protein_id="ABK36987.1"
FT                   /translation="MVLTRRQLARARRWLPLWSLLMVLMSFGSRAATDLCTLTPHCSQS
FT                   ERTLEKAMPCGSFTSALAMTVLTGDSLTVAMLEPDTPDFISPSQFMPDVPTDRLERPPR
FT                   HLG"
     MVLTRRQLAR ARRWLPLWSL LMVLMSFGSR AATDLCTLTP HCSQSERTLE KAMPCGSFTS        60
     ALAMTVLTGD SLTVAMLEPD TPDFISPSQF MPDVPTDRLE RPPRHLG                     107
//

If you have problems or comments...

PBIL Back to PBIL home page