(data stored in ACNUC7421 zone)

EMBL: CP000462.PE323

CP000462.PE323       Location/Qualifiers
FT   CDS             362990..363421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04214"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37618"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF54"
FT                   /protein_id="ABK37618.1"
FT                   /translation="MYKSLLLAVLAGTVSFSALATEQMTVYKSQYCGCCKTWIKHMEEN
FT                   GFEVKVVETEQLEPVKQQYGITPQLASCHTGVVNGYVVEGHVPAADVQKLLKEKPAIRG
FT                   LTIPGMPQSAPGMDIPGQPYQVLSISNEGATKVWSSYPG"
     MYKSLLLAVL AGTVSFSALA TEQMTVYKSQ YCGCCKTWIK HMEENGFEVK VVETEQLEPV        60
     KQQYGITPQL ASCHTGVVNG YVVEGHVPAA DVQKLLKEKP AIRGLTIPGM PQSAPGMDIP       120
     GQPYQVLSIS NEGATKVWSS YPG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page