(data stored in ACNUC7421 zone)

EMBL: CP000462.PE324

CP000462.PE324       Location/Qualifiers
FT   CDS             363580..365799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0348"
FT                   /product="protease II"
FT                   /EC_number="3.4.21.83"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39710"
FT                   /db_xref="GOA:A0KF55"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF55"
FT                   /protein_id="ABK39710.1"
FT                   /translation="MIPCPRSQGSGPPTLLQRKGCDMFTFSRGLLLLACLAAVPCSYAN
FT                   DESAMPTSDTLIQPPVAAKHPHAIKKHGDTRVDNYYWLRDDERQKPEVLAYLEAENAYT
FT                   DAMLKPIKPLRDQLYQEMVARIPQQDESVPYVKNGYRYQTRYEPGKEYAIYSRSKLGEE
FT                   AASLLLDGNQRAEGHEFYALGALEVSRNNRWLAVAEDFLSRRQYQIQFLDLESGKWAAE
FT                   LLPNTSGNLVWANDSKTVFYVRKHPKTLLPYQVYRHELGTEPAKDQLVYEEKDDSFYVS
FT                   LYATTSEDFIVIALSSTTSGEARLIDANVPTQAPRLFLPRQVDHEYSLDHYRGRFYVRS
FT                   NKDGKNFGLYETKESPVDRWKAVIAPNPDVLLESYALFKEWLVLEERSQGLTRLRQVNW
FT                   QSGEQKEIAFDDPAYVTWLAYNPEPDTSALRYGYSSMTTPSSTYELDLNSGKRTLLKQQ
FT                   PVAGFKAEQYASERLWITARDGVAVPVSLVYRKDKFKQEGAGTHTNPLLVYGYGSYGAS
FT                   MDPDFSSARLSLLDRGFVYAIAHIRGGEELGRHWYEDGKLLKKQNTFNDFIDVTEALVA
FT                   QGYGAKDQVYAMGGSAGGLLMGAVINQAPQLYRGVVAQVPFVDVVTTMLDESIPLTTGE
FT                   YDEWGNPNQKRYYDYMKAYSPYDQVKAQAYPNLLVTTGLHDSQVQYWEPAKWVAKLREL
FT                   KTDDNKLLLSTDMDAGHGGKSGRFKAYEDIALEFAFILDLAKPQA"
     MIPCPRSQGS GPPTLLQRKG CDMFTFSRGL LLLACLAAVP CSYANDESAM PTSDTLIQPP        60
     VAAKHPHAIK KHGDTRVDNY YWLRDDERQK PEVLAYLEAE NAYTDAMLKP IKPLRDQLYQ       120
     EMVARIPQQD ESVPYVKNGY RYQTRYEPGK EYAIYSRSKL GEEAASLLLD GNQRAEGHEF       180
     YALGALEVSR NNRWLAVAED FLSRRQYQIQ FLDLESGKWA AELLPNTSGN LVWANDSKTV       240
     FYVRKHPKTL LPYQVYRHEL GTEPAKDQLV YEEKDDSFYV SLYATTSEDF IVIALSSTTS       300
     GEARLIDANV PTQAPRLFLP RQVDHEYSLD HYRGRFYVRS NKDGKNFGLY ETKESPVDRW       360
     KAVIAPNPDV LLESYALFKE WLVLEERSQG LTRLRQVNWQ SGEQKEIAFD DPAYVTWLAY       420
     NPEPDTSALR YGYSSMTTPS STYELDLNSG KRTLLKQQPV AGFKAEQYAS ERLWITARDG       480
     VAVPVSLVYR KDKFKQEGAG THTNPLLVYG YGSYGASMDP DFSSARLSLL DRGFVYAIAH       540
     IRGGEELGRH WYEDGKLLKK QNTFNDFIDV TEALVAQGYG AKDQVYAMGG SAGGLLMGAV       600
     INQAPQLYRG VVAQVPFVDV VTTMLDESIP LTTGEYDEWG NPNQKRYYDY MKAYSPYDQV       660
     KAQAYPNLLV TTGLHDSQVQ YWEPAKWVAK LRELKTDDNK LLLSTDMDAG HGGKSGRFKA       720
     YEDIALEFAF ILDLAKPQA                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page