(data stored in ACNUC7421 zone)

EMBL: CP000462.PE325

CP000462.PE325       Location/Qualifiers
FT   CDS             366071..367186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0349"
FT                   /product="trap transporter solute receptor, taxi family"
FT                   /note="identified by match to protein family HMM TIGR02122"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38189"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF56"
FT                   /protein_id="ABK38189.1"
FT                   /translation="MLVAFWGTFAVHPLPHIEVMGNRRRRTVVCPAFARGTGELNQSKR
FT                   MNNMKGLSLACALSAVLAGVSFGGPVQAQERFVTIGTGGQTGVYYVAGQSICRFLNRGA
FT                   ADHQIKCNAPASGGGVANVNGIRSGEFNFGIMQSDHQYKAMKGLPPFQAEGAMDDMRAV
FT                   FSLQSEVFTILARKDAKIAGFDDLKGKRVNIGNPGSGQRDTFEEIMAVKGWKKGDFGLV
FT                   SELKPAEQASALGDNNIDAMSYFVGHPNGAIQEASTTTDAVLVPVTGADIDKLLAEKSY
FT                   YSKAEIPGGIYKGSDQPTPSIGGKAVLSTSAKADPEVVYQLVKSVFDNLDRFKRLHPAF
FT                   ADLKEADMIKVGLSAPLHEGAARYYKERGWL"
     MLVAFWGTFA VHPLPHIEVM GNRRRRTVVC PAFARGTGEL NQSKRMNNMK GLSLACALSA        60
     VLAGVSFGGP VQAQERFVTI GTGGQTGVYY VAGQSICRFL NRGAADHQIK CNAPASGGGV       120
     ANVNGIRSGE FNFGIMQSDH QYKAMKGLPP FQAEGAMDDM RAVFSLQSEV FTILARKDAK       180
     IAGFDDLKGK RVNIGNPGSG QRDTFEEIMA VKGWKKGDFG LVSELKPAEQ ASALGDNNID       240
     AMSYFVGHPN GAIQEASTTT DAVLVPVTGA DIDKLLAEKS YYSKAEIPGG IYKGSDQPTP       300
     SIGGKAVLST SAKADPEVVY QLVKSVFDNL DRFKRLHPAF ADLKEADMIK VGLSAPLHEG       360
     AARYYKERGW L                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page