(data stored in ACNUC7421 zone)

EMBL: CP000462.PE329

CP000462.PE329       Location/Qualifiers
FT   CDS             370361..370987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0353"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38746"
FT                   /db_xref="GOA:A0KF60"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF60"
FT                   /protein_id="ABK38746.1"
FT                   /translation="MLLSFLIIASGWWHIRAAYGSDSRQFYISKPLTMLLIIALAFGYQ
FT                   SYDHDGSHAWILLGLCLSLAGDVLLMLPSDRFIQGLAAFFVAHLCYIVGFAQGPLVLNL
FT                   VDGLLLLLVAGMVFGLLWGKLGEMKVPVFCYMLVIIGMAWVAAGAWHASLTAGSAAALV
FT                   GALMFLFSDSMLALDRFRRPFPHATAWVMTSYFAAQFLIAASLAG"
     MLLSFLIIAS GWWHIRAAYG SDSRQFYISK PLTMLLIIAL AFGYQSYDHD GSHAWILLGL        60
     CLSLAGDVLL MLPSDRFIQG LAAFFVAHLC YIVGFAQGPL VLNLVDGLLL LLVAGMVFGL       120
     LWGKLGEMKV PVFCYMLVII GMAWVAAGAW HASLTAGSAA ALVGALMFLF SDSMLALDRF       180
     RRPFPHATAW VMTSYFAAQF LIAASLAG                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page