(data stored in ACNUC7421 zone)

EMBL: CP000462.PE330

CP000462.PE330       Location/Qualifiers
FT   CDS             complement(371078..372631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0354"
FT                   /product="multidrug resistance protein B"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39189"
FT                   /db_xref="GOA:A0KF61"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF61"
FT                   /protein_id="ABK39189.1"
FT                   /translation="MEPIPRRNWIAVMGGLIGAFMAILDIQITNASLKDIQGALSATLS
FT                   ESSWISTSYLVAEMIAIPLSGWLSRGLSVRRYLLWTTGAFIVASVLCSFSWNLTSMIVF
FT                   RALQGFTGGALIPMAFSLIVSLLPLHKRATGMALFGLCATFAPAIGPTLGGWLTEQMSW
FT                   HYIFYMNVPPGLLVMAMLAHGLDKKPVDWEVIKRVDLIGIVTMAVGLGLLEVVLEEGNR
FT                   EDWFGSSFIVRLTVISVVALVFFVISQLLRRHPLVNLRLLHNPRFALACFAYLVLGMAL
FT                   MGSIYVLPLYMTQIHNYNALEIGEVLMWMGLPQLLVLPLVPRLTHKIDPRYLVSFGFLV
FT                   FAVSCFMNMNMSADYAGPQLIQSLIVRALGQPFIMVPLSLVATASLTHDEIPSSSTLLN
FT                   VLRNLGGAFGIAIIATLIDNDTRIHVSQISSTLAASSIEGQSYLLQLAQTMMAQGSGPE
FT                   LARQQAQAMLSNTISREAAIMAYNQVFFVMGIFLLLASGLMLLLKQPAPRAADAEPLEA
FT                   "
     MEPIPRRNWI AVMGGLIGAF MAILDIQITN ASLKDIQGAL SATLSESSWI STSYLVAEMI        60
     AIPLSGWLSR GLSVRRYLLW TTGAFIVASV LCSFSWNLTS MIVFRALQGF TGGALIPMAF       120
     SLIVSLLPLH KRATGMALFG LCATFAPAIG PTLGGWLTEQ MSWHYIFYMN VPPGLLVMAM       180
     LAHGLDKKPV DWEVIKRVDL IGIVTMAVGL GLLEVVLEEG NREDWFGSSF IVRLTVISVV       240
     ALVFFVISQL LRRHPLVNLR LLHNPRFALA CFAYLVLGMA LMGSIYVLPL YMTQIHNYNA       300
     LEIGEVLMWM GLPQLLVLPL VPRLTHKIDP RYLVSFGFLV FAVSCFMNMN MSADYAGPQL       360
     IQSLIVRALG QPFIMVPLSL VATASLTHDE IPSSSTLLNV LRNLGGAFGI AIIATLIDND       420
     TRIHVSQISS TLAASSIEGQ SYLLQLAQTM MAQGSGPELA RQQAQAMLSN TISREAAIMA       480
     YNQVFFVMGI FLLLASGLML LLKQPAPRAA DAEPLEA                                517
//

If you have problems or comments...

PBIL Back to PBIL home page