(data stored in ACNUC7421 zone)

EMBL: CP000462.PE335

CP000462.PE335       Location/Qualifiers
FT   CDS             376422..376805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0359"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37584"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF66"
FT                   /protein_id="ABK37584.1"
FT                   /translation="MPHYRQSRGHHQYGRREIGNLLAYIKVVGSGAGFNRHQICLFKRF
FT                   AMTQSVHGHEVMEMMLAHGGQFTRASLKQAIDERFGAEARFHTCSASEMDAEALIDFLA
FT                   KRGKFIESEQGFQTHADKICNHG"
     MPHYRQSRGH HQYGRREIGN LLAYIKVVGS GAGFNRHQIC LFKRFAMTQS VHGHEVMEMM        60
     LAHGGQFTRA SLKQAIDERF GAEARFHTCS ASEMDAEALI DFLAKRGKFI ESEQGFQTHA       120
     DKICNHG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page