(data stored in ACNUC7421 zone)

EMBL: CP000462.PE337

CP000462.PE337       Location/Qualifiers
FT   CDS             complement(377612..378580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0361"
FT                   /product="HTH-type transcriptional regulator YidZ"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36795"
FT                   /db_xref="GOA:A0KF68"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF68"
FT                   /protein_id="ABK36795.1"
FT                   /translation="MLLEQLGRIDLNLLIILQVLLEERNGSRAARRLHLSQSAVSKALG
FT                   RLRETFDDPLFVRSAYGLEPTARALSLQQQLQPILLSLDNLIQPPDFDPTTTEREFVIA
FT                   SMDSAFTLFAPLYLSELKRQAPGIRLRYEEWTENSLTEMSQGQVDIAFTVRENCINSDF
FT                   RLDTLPNAICQRLLAIDDLTCLVQHDHPALHEPEWDLTRYLAYPHVQTYCEGRDRWMLD
FT                   HKLAEQDLYRRIEATVPSFEAALRMGMHSDMIVTLSRLYARHATQVYPLVPLPLPIALD
FT                   SISHLLIWHQRHEEDPGHRWLRETLLTLIMGKLEPTAAEPS"
     MLLEQLGRID LNLLIILQVL LEERNGSRAA RRLHLSQSAV SKALGRLRET FDDPLFVRSA        60
     YGLEPTARAL SLQQQLQPIL LSLDNLIQPP DFDPTTTERE FVIASMDSAF TLFAPLYLSE       120
     LKRQAPGIRL RYEEWTENSL TEMSQGQVDI AFTVRENCIN SDFRLDTLPN AICQRLLAID       180
     DLTCLVQHDH PALHEPEWDL TRYLAYPHVQ TYCEGRDRWM LDHKLAEQDL YRRIEATVPS       240
     FEAALRMGMH SDMIVTLSRL YARHATQVYP LVPLPLPIAL DSISHLLIWH QRHEEDPGHR       300
     WLRETLLTLI MGKLEPTAAE PS                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page