(data stored in ACNUC7421 zone)

EMBL: CP000462.PE339

CP000462.PE339       Location/Qualifiers
FT   CDS             379030..379332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04175"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38086"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF70"
FT                   /protein_id="ABK38086.1"
FT                   /translation="MSVEEKVELNETCDSCGCFAEIGTIIGEGDDVMELVIEAAAEADA
FT                   RAKLAAYEALAKQVTAEATSSSELSQGANGVILKARLQFTCTAEKLIFEMRARSI"
     MSVEEKVELN ETCDSCGCFA EIGTIIGEGD DVMELVIEAA AEADARAKLA AYEALAKQVT        60
     AEATSSSELS QGANGVILKA RLQFTCTAEK LIFEMRARSI                             100
//

If you have problems or comments...

PBIL Back to PBIL home page