(data stored in ACNUC7421 zone)

EMBL: CP000462.PE343

CP000462.PE343       Location/Qualifiers
FT   CDS             384214..384834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0367"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37759"
FT                   /db_xref="GOA:A0KF74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF74"
FT                   /protein_id="ABK37759.1"
FT                   /translation="MGIRAQQKEKTRRTLIEAAFSQLCANRSFSNLSLREVAREAGIAP
FT                   TSFYRHFRDMEELGLTLVDEGGLTLRQLMRQARQRIAGGGSVISTSVQTFMEFVENNPN
FT                   IFRLLLRERSGTSAAFRQAVAREIQHFIAELTDYLEATTGAPREEAYIQAEAMVTIVFS
FT                   AGADALDMTSEECRALSDRTIRQLRMIAMGAEVQNQKRREPLS"
     MGIRAQQKEK TRRTLIEAAF SQLCANRSFS NLSLREVARE AGIAPTSFYR HFRDMEELGL        60
     TLVDEGGLTL RQLMRQARQR IAGGGSVIST SVQTFMEFVE NNPNIFRLLL RERSGTSAAF       120
     RQAVAREIQH FIAELTDYLE ATTGAPREEA YIQAEAMVTI VFSAGADALD MTSEECRALS       180
     DRTIRQLRMI AMGAEVQNQK RREPLS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page