(data stored in ACNUC7421 zone)

EMBL: CP000462.PE345

CP000462.PE345       Location/Qualifiers
FT   CDS             complement(385259..385570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39835"
FT                   /db_xref="GOA:A0KF76"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF76"
FT                   /protein_id="ABK39835.1"
FT                   /translation="MKRVFNLLAMGLILFFWFGVLVSLIAPLPGKLNGFLPVCGVIVAL
FT                   MHWVQASMVKAACKPYFAVSRLEFTQVLVFGVFGMVEIRTRLQAIVDAKQRGTDNKAG"
     MKRVFNLLAM GLILFFWFGV LVSLIAPLPG KLNGFLPVCG VIVALMHWVQ ASMVKAACKP        60
     YFAVSRLEFT QVLVFGVFGM VEIRTRLQAI VDAKQRGTDN KAG                         103
//

If you have problems or comments...

PBIL Back to PBIL home page