(data stored in ACNUC7421 zone)

EMBL: CP000462.PE346

CP000462.PE346       Location/Qualifiers
FT   CDS             complement(385681..386310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0370"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39151"
FT                   /db_xref="GOA:A0KF77"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF77"
FT                   /protein_id="ABK39151.1"
FT                   /translation="MPRVKSSRNGPSKSPAPQGKSGFVRIISGQWRGRKLPVRDVEGLR
FT                   PTTDRVKETIFNWLAPHVRGTRCLDLFAGSGGLGLEALSRYAEQVTLIEMDKGAADQIK
FT                   KNLTTLGSSQGQVIQSDAVSWLQGPATPFDLVFLDPPFRRELLPQVCELLEQRGWLAPD
FT                   ALIYLEREKEMADLPLPASWQLLKDKQAGQVCYQLYLRDTKHDAAV"
     MPRVKSSRNG PSKSPAPQGK SGFVRIISGQ WRGRKLPVRD VEGLRPTTDR VKETIFNWLA        60
     PHVRGTRCLD LFAGSGGLGL EALSRYAEQV TLIEMDKGAA DQIKKNLTTL GSSQGQVIQS       120
     DAVSWLQGPA TPFDLVFLDP PFRRELLPQV CELLEQRGWL APDALIYLER EKEMADLPLP       180
     ASWQLLKDKQ AGQVCYQLYL RDTKHDAAV                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page