(data stored in ACNUC7421 zone)

EMBL: CP000462.PE347

CP000462.PE347       Location/Qualifiers
FT   CDS             386421..388322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0371"
FT                   /product="cell division protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38711"
FT                   /db_xref="GOA:A0KF78"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF78"
FT                   /protein_id="ABK38711.1"
FT                   /translation="MAKGLFSWLGFGRKKEEAEAVQPQTPQATPITAEPEVAAAPAPVS
FT                   DPTPAVAAEVPASAQNSVLHDDCCPPAELDDHGPLVVEECASDLEPVIVNEALLAEEER
FT                   AAAQAQAQEAARVAAELKAAQEVRIAAEARAAEEARIAAEARTAEEARLAAEARAAEEA
FT                   RIAAEARAAEEARLAAEARAAEEARVAAEARAVKEARIAAEASAAEETRIAAEARAAEE
FT                   ARIAAEARAAEEARLAAEARAAEEARIAAEARAAEEARLAAEARAAEEARLAAEAQAAE
FT                   EARLAKEAQRVEDLRLVAEMEAEAAALAALPLAAKVDDDTQEKPQREGFFARLKRSLVR
FT                   TRENIGSGFFGLFRGKKIDDELFEELETQLLTADLGVDTTSRIIEGLVQHADRKQLKDA
FT                   EALYGLLKQDMGEMLAKVEQPLVIDTSKKPYVILMVGVNGVGKTTTIGKLAKQFQAEGK
FT                   SVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIYDAIEAARSRGADVLIA
FT                   DTAGRLQNKSNLMEELKKVVRVMKKLDDAAPHEIMLTLDAGTGQNALSQAKLFSEAVGL
FT                   TGITLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDFIEALFSREE"
     MAKGLFSWLG FGRKKEEAEA VQPQTPQATP ITAEPEVAAA PAPVSDPTPA VAAEVPASAQ        60
     NSVLHDDCCP PAELDDHGPL VVEECASDLE PVIVNEALLA EEERAAAQAQ AQEAARVAAE       120
     LKAAQEVRIA AEARAAEEAR IAAEARTAEE ARLAAEARAA EEARIAAEAR AAEEARLAAE       180
     ARAAEEARVA AEARAVKEAR IAAEASAAEE TRIAAEARAA EEARIAAEAR AAEEARLAAE       240
     ARAAEEARIA AEARAAEEAR LAAEARAAEE ARLAAEAQAA EEARLAKEAQ RVEDLRLVAE       300
     MEAEAAALAA LPLAAKVDDD TQEKPQREGF FARLKRSLVR TRENIGSGFF GLFRGKKIDD       360
     ELFEELETQL LTADLGVDTT SRIIEGLVQH ADRKQLKDAE ALYGLLKQDM GEMLAKVEQP       420
     LVIDTSKKPY VILMVGVNGV GKTTTIGKLA KQFQAEGKSV MLAAGDTFRA AAVEQLQVWG       480
     QRNNIPVIAQ HTGADSASVI YDAIEAARSR GADVLIADTA GRLQNKSNLM EELKKVVRVM       540
     KKLDDAAPHE IMLTLDAGTG QNALSQAKLF SEAVGLTGIT LTKLDGTAKG GVIFAVADKF       600
     QIPIRYIGVG EGIDDLRPFV ANDFIEALFS REE                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page