(data stored in ACNUC7421 zone)

EMBL: CP000462.PE349

CP000462.PE349       Location/Qualifiers
FT   CDS             389081..390034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0373"
FT                   /product="cell division membrane protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37573"
FT                   /db_xref="GOA:A0KF80"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF80"
FT                   /protein_id="ABK37573.1"
FT                   /translation="MAIVRHKQPPLRRFMMYWVDHARQAFSSLGELWRNPLASLMTLAV
FT                   LGVSLALPSCFHVLLKNAEVVEGSWQTSSQISLYLRKDLPEQNILDMKQRILLYPEVES
FT                   VTYMSRDEALKEFREISGFGDALDYLDSNPLPPVLSVIPDPRWQNPEGAAELLNKLNNE
FT                   DGVEQGKLDLQWLTRLQGIMNLLRHTITGIAVLLLSAVLLIVGNTLRLNILNQRSEIEV
FT                   LKLVGATDAFIHRPFLYTGIWFGVIGGMLAWWLTEVMVIWSEGVVKELAGLYNSNFRLV
FT                   GMGAVDGINLILLGALLGLIASWFSVHRHIRDIEPS"
     MAIVRHKQPP LRRFMMYWVD HARQAFSSLG ELWRNPLASL MTLAVLGVSL ALPSCFHVLL        60
     KNAEVVEGSW QTSSQISLYL RKDLPEQNIL DMKQRILLYP EVESVTYMSR DEALKEFREI       120
     SGFGDALDYL DSNPLPPVLS VIPDPRWQNP EGAAELLNKL NNEDGVEQGK LDLQWLTRLQ       180
     GIMNLLRHTI TGIAVLLLSA VLLIVGNTLR LNILNQRSEI EVLKLVGATD AFIHRPFLYT       240
     GIWFGVIGGM LAWWLTEVMV IWSEGVVKEL AGLYNSNFRL VGMGAVDGIN LILLGALLGL       300
     IASWFSVHRH IRDIEPS                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page