(data stored in ACNUC7421 zone)

EMBL: CP000462.PE35

CP000462.PE35        Location/Qualifiers
FT   CDS             complement(42129..44246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0039"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase ((ppGpp)ase)"
FT                   /EC_number="3.1.7.2"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF02824; match to protein family HMM PF04607;
FT                   match to protein family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39363"
FT                   /db_xref="GOA:A0KR26"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR26"
FT                   /protein_id="ABK39363.1"
FT                   /translation="MYLFENLKEIASSYLPPEQVEKLRQAYVVARDAHQGQMRSSGEPY
FT                   ITHPVAVARILGDMRLDHETLMAAVLHDVIEDTPVTKADLAELFGDAVAELVAGVSKLD
FT                   KLKFRDRKEAQAENFRKMVMAMTQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIFAPIANRLGIHTMKNELEELGFEALYPMRSRVLRESVRRARGNRREIIDSIQSEIEG
FT                   RLREAGIESQVSGREKNLFSIYNKMEKKELQFHEVMDIYAFRVRVKDIDTCYRVLGQMH
FT                   SLYKPRPGRFKDYIAIPKTNGYQSLHTSLVGPHGVPVEVQIRTEFMDQMADKGVAAHWA
FT                   YKQDGDSSGTTAQIRAQRWMQSLLELQQSAGSSFEFIEGVKTDLFPDEIYVFTPEGRIM
FT                   ELPAGATPVDFAYTVHTDIGHACVGSRVDRHPYPLSSPLHSGQTVEIITAPGARPNAAW
FT                   LNFVVTTKARSKIRQFLKNLRTEESVVLGRRLLNHALGAKNIEDIPEPRIKQVLADTKH
FT                   ENLQGLLADVGLGNAMSVMVARRMLGDELPPEEQPKSSSKKMPIKGADGMLVTFANCCR
FT                   PIPGDAIIAHISPGKGLVIHQEACRNIKGYSKEPDKYLPVQWEVDKEQEQEFRTGISIE
FT                   IVNHQGALAELANVIAATGANIHAISTEEKDGRVYLVTLLITTKSRIHLANIMRKIRVM
FT                   PNVLKVSRQKN"
     MYLFENLKEI ASSYLPPEQV EKLRQAYVVA RDAHQGQMRS SGEPYITHPV AVARILGDMR        60
     LDHETLMAAV LHDVIEDTPV TKADLAELFG DAVAELVAGV SKLDKLKFRD RKEAQAENFR       120
     KMVMAMTQDI RVILIKLADR THNMRTLGSL RPDKRRRIAR ETLEIFAPIA NRLGIHTMKN       180
     ELEELGFEAL YPMRSRVLRE SVRRARGNRR EIIDSIQSEI EGRLREAGIE SQVSGREKNL       240
     FSIYNKMEKK ELQFHEVMDI YAFRVRVKDI DTCYRVLGQM HSLYKPRPGR FKDYIAIPKT       300
     NGYQSLHTSL VGPHGVPVEV QIRTEFMDQM ADKGVAAHWA YKQDGDSSGT TAQIRAQRWM       360
     QSLLELQQSA GSSFEFIEGV KTDLFPDEIY VFTPEGRIME LPAGATPVDF AYTVHTDIGH       420
     ACVGSRVDRH PYPLSSPLHS GQTVEIITAP GARPNAAWLN FVVTTKARSK IRQFLKNLRT       480
     EESVVLGRRL LNHALGAKNI EDIPEPRIKQ VLADTKHENL QGLLADVGLG NAMSVMVARR       540
     MLGDELPPEE QPKSSSKKMP IKGADGMLVT FANCCRPIPG DAIIAHISPG KGLVIHQEAC       600
     RNIKGYSKEP DKYLPVQWEV DKEQEQEFRT GISIEIVNHQ GALAELANVI AATGANIHAI       660
     STEEKDGRVY LVTLLITTKS RIHLANIMRK IRVMPNVLKV SRQKN                       705
//

If you have problems or comments...

PBIL Back to PBIL home page