(data stored in ACNUC7421 zone)

EMBL: CP000462.PE351

CP000462.PE351       Location/Qualifiers
FT   CDS             391471..392130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0375"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36352"
FT                   /db_xref="GOA:A0KF82"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF82"
FT                   /protein_id="ABK36352.1"
FT                   /translation="MKLLNDLFTNNREWAERIKAEDPEFFATLSAQQAPEYLWIGCSDS
FT                   RVPANQLMGLLPGDVFVHRNVANLVVHTDFNCLSVLQYAVEVLKVKHIIVCGHYGCGGV
FT                   KAAMQNQELGLIDNWLRNIKDVYFKYREQLDAIEDEHERFDYLCELNVAEQVANVCHTT
FT                   IIQNAWRKGQELAVHGWIYGIKDGLLHDLDLCISGPEQIPDVYRAWPDMRPPHRRR"
     MKLLNDLFTN NREWAERIKA EDPEFFATLS AQQAPEYLWI GCSDSRVPAN QLMGLLPGDV        60
     FVHRNVANLV VHTDFNCLSV LQYAVEVLKV KHIIVCGHYG CGGVKAAMQN QELGLIDNWL       120
     RNIKDVYFKY REQLDAIEDE HERFDYLCEL NVAEQVANVC HTTIIQNAWR KGQELAVHGW       180
     IYGIKDGLLH DLDLCISGPE QIPDVYRAWP DMRPPHRRR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page