(data stored in ACNUC7421 zone)

EMBL: CP000462.PE357

CP000462.PE357       Location/Qualifiers
FT   CDS             complement(398545..399642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0381"
FT                   /product="calcium/proton antiporter"
FT                   /note="identified by match to protein family HMM PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36479"
FT                   /db_xref="GOA:A0KF88"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF88"
FT                   /protein_id="ABK36479.1"
FT                   /translation="MKSFIRQEIALPVGLLTLLFFKTLGSDLLTEATPLGIYLPVSAML
FT                   LAIVTWAIFSVVRHSDALAIKLGEPFGTLILTLSVISLEVVMISSVMLTGEPNPVMARD
FT                   TMFAVVMLVTNGLVGFTLLFGGWRYHTQSFNLDGVKSYLVAIIPLALLCLVLPNFTEGG
FT                   NIGSMSSAMSWMLIIISVLLYGVFLLIQTRSHSHFFIDSDHEDYEEHHGPLQSNVYHTL
FT                   LLLAYLVVVILLAKTLAIPINHGVKVLAAPPALGGFIVACIVLAPEAVGAIKAAFNNQL
FT                   QRAMNLYFGSVLATIALTVPAVLFIGAMLGQEVRLGLSAADMVLLFTTLMVCKVTFSSG
FT                   RTNVLHGATHLVLFVVYLFLMFEHE"
     MKSFIRQEIA LPVGLLTLLF FKTLGSDLLT EATPLGIYLP VSAMLLAIVT WAIFSVVRHS        60
     DALAIKLGEP FGTLILTLSV ISLEVVMISS VMLTGEPNPV MARDTMFAVV MLVTNGLVGF       120
     TLLFGGWRYH TQSFNLDGVK SYLVAIIPLA LLCLVLPNFT EGGNIGSMSS AMSWMLIIIS       180
     VLLYGVFLLI QTRSHSHFFI DSDHEDYEEH HGPLQSNVYH TLLLLAYLVV VILLAKTLAI       240
     PINHGVKVLA APPALGGFIV ACIVLAPEAV GAIKAAFNNQ LQRAMNLYFG SVLATIALTV       300
     PAVLFIGAML GQEVRLGLSA ADMVLLFTTL MVCKVTFSSG RTNVLHGATH LVLFVVYLFL       360
     MFEHE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page