(data stored in ACNUC7421 zone)

EMBL: CP000462.PE358

CP000462.PE358       Location/Qualifiers
FT   CDS             complement(399804..401171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0382"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38015"
FT                   /db_xref="GOA:A0KF89"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF89"
FT                   /protein_id="ABK38015.1"
FT                   /translation="MDESIRAQLAQFTFDCGQKDMALLRDPRFYSRHIRIQGLKLASGT
FT                   GCSSLGVDLPFTAADLPPYPSQELFGLAATQARFNTEQELVAYFHVGNNTAYWVLNNSW
FT                   SHALLQYPCTDCFYLEFHQQTPDEAMPVFPRGNKSIKEEGGSQSLSFFDPNNHIKQTLW
FT                   AGKALEHYAQQQARHYGFWGGAAVGALLVAAYWGLRNYRRSLKGLLQAGLARREFVPFY
FT                   QPVVDSRSLQVVGFEALLRWQRGGDLIPPGAFIDYAEEQQLILPMTSQLLEKVIADLPR
FT                   LAPGQWVSVNIVAAHLEHPHLRNLLLQHGWPSPAQLTFELTERKPITDIKTAVIEITAL
FT                   QQQGYHFKLDDFGTGYGGFAYLQRLGIRQIKIDKMFVDTIGTDDLKRSVLDATIAFGRE
FT                   SGMEMIAEGVERQDQVDYLQQHGVHLIQGYVYAQPMALTKLKIWLLAWYQNHTGER"
     MDESIRAQLA QFTFDCGQKD MALLRDPRFY SRHIRIQGLK LASGTGCSSL GVDLPFTAAD        60
     LPPYPSQELF GLAATQARFN TEQELVAYFH VGNNTAYWVL NNSWSHALLQ YPCTDCFYLE       120
     FHQQTPDEAM PVFPRGNKSI KEEGGSQSLS FFDPNNHIKQ TLWAGKALEH YAQQQARHYG       180
     FWGGAAVGAL LVAAYWGLRN YRRSLKGLLQ AGLARREFVP FYQPVVDSRS LQVVGFEALL       240
     RWQRGGDLIP PGAFIDYAEE QQLILPMTSQ LLEKVIADLP RLAPGQWVSV NIVAAHLEHP       300
     HLRNLLLQHG WPSPAQLTFE LTERKPITDI KTAVIEITAL QQQGYHFKLD DFGTGYGGFA       360
     YLQRLGIRQI KIDKMFVDTI GTDDLKRSVL DATIAFGRES GMEMIAEGVE RQDQVDYLQQ       420
     HGVHLIQGYV YAQPMALTKL KIWLLAWYQN HTGER                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page