(data stored in ACNUC7421 zone)

EMBL: CP000462.PE363

CP000462.PE363       Location/Qualifiers
FT   CDS             405890..406483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37696"
FT                   /db_xref="GOA:A0KF94"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF94"
FT                   /protein_id="ABK37696.1"
FT                   /translation="MKRQINLYGAEFRPRRQWASLNQMALVWGGSVLLLLCAAGVIAWQ
FT                   QHAVERELVQVRAALEIKRGEAQRLDAELARHQADGLLQQQLATKQEELTAKQGLMRQL
FT                   GSLALQKSQGYAGLMADLSRIRDPQLSLQRIEIADGYVNLSGFAGRSQDVPAWVNRFKQ
FT                   TPSLVGKQFGELTLSRDKEGRLAFQLSGIEREKP"
     MKRQINLYGA EFRPRRQWAS LNQMALVWGG SVLLLLCAAG VIAWQQHAVE RELVQVRAAL        60
     EIKRGEAQRL DAELARHQAD GLLQQQLATK QEELTAKQGL MRQLGSLALQ KSQGYAGLMA       120
     DLSRIRDPQL SLQRIEIADG YVNLSGFAGR SQDVPAWVNR FKQTPSLVGK QFGELTLSRD       180
     KEGRLAFQLS GIEREKP                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page