(data stored in ACNUC7421 zone)

EMBL: CP000462.PE366

CP000462.PE366       Location/Qualifiers
FT   CDS             409271..410161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0390"
FT                   /product="general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36249"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF97"
FT                   /protein_id="ABK36249.1"
FT                   /translation="MYLNHFGLQEAPFGLTPNTGFYYGLPPHEEALQVLNWALAQGEGF
FT                   IKVTGEVGTGKTLLCRKLLSELGSEERPVRLAWLPNPHLNPAELRIALALELGLAVRDQ
FT                   SELDLTDRIHRHLIALHQQGSRVVVLIDEAQALPDETLEAIRLFGNLETESSKLLQIVL
FT                   FGQPELDARLAKPYLRQLRQRIGFSYCLRPLRFDETRAYLEHRLQISGYRGAPLFGGRA
FT                   LRQLWRASRGIPRLINILAQKCLMLAYGQGARQIDSRLVRLAVRDTDDARRFVPRRWWP
FT                   LVLLLGCALAYGVWQ"
     MYLNHFGLQE APFGLTPNTG FYYGLPPHEE ALQVLNWALA QGEGFIKVTG EVGTGKTLLC        60
     RKLLSELGSE ERPVRLAWLP NPHLNPAELR IALALELGLA VRDQSELDLT DRIHRHLIAL       120
     HQQGSRVVVL IDEAQALPDE TLEAIRLFGN LETESSKLLQ IVLFGQPELD ARLAKPYLRQ       180
     LRQRIGFSYC LRPLRFDETR AYLEHRLQIS GYRGAPLFGG RALRQLWRAS RGIPRLINIL       240
     AQKCLMLAYG QGARQIDSRL VRLAVRDTDD ARRFVPRRWW PLVLLLGCAL AYGVWQ           296
//

If you have problems or comments...

PBIL Back to PBIL home page