(data stored in ACNUC7421 zone)

EMBL: CP000462.PE368

CP000462.PE368       Location/Qualifiers
FT   CDS             411288..412997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0392"
FT                   /product="type IV pilin"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM PF05157"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39289"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF99"
FT                   /protein_id="ABK39289.1"
FT                   /translation="MAQPRLKMRLGDLLVQEQIISDDQLQLALQQQRQTGRKLGTTLID
FT                   LGFISEVQLLQFLARQLDVPFFDLNNLTIDASAVPLLPEVQARRYRALAVNLTDNKVTV
FT                   AMSDPADLSALDAIAALLRPREMGLAVAREGQLLEYFDRLYRRTREIESFAEQLHEEYQ
FT                   DAGFELGSSNLGAGDEGEATVAKLLRSLFEDAVQVGASDIHIEPDEKVLRIRQRIDGIL
FT                   HENILSEVRIAQALVLRLKLVAGLDISEKRLPQDGRFNMKVRGRDVDVRMSTMPVQYGE
FT                   SVVMRLLDQSSGILSLTETGMPPEILTRFRRQLKRPHGMILVTGPTGSGKTTTLYGALS
FT                   ELNQASQKIITVEDPVEYRLPRVNQVQVNPKIGLTFSHVLRSTLRQDPDILLVGEMRDN
FT                   ETVEIGLRGAITGHLVLTTLHTNDAVTSALRLIDMGAPGYLVASALRAVVAQRLVRRVC
FT                   EHCVEEKAPDEGQATWLTVLSGEAPGQHVYHKGRGCQSCNFTGYAGRIGVYELLELDQP
FT                   MMDSLRRNDAEGFAKAARQHPHYRPLALTALDYARQGITSVDEVLRLAEDLG"
     MAQPRLKMRL GDLLVQEQII SDDQLQLALQ QQRQTGRKLG TTLIDLGFIS EVQLLQFLAR        60
     QLDVPFFDLN NLTIDASAVP LLPEVQARRY RALAVNLTDN KVTVAMSDPA DLSALDAIAA       120
     LLRPREMGLA VAREGQLLEY FDRLYRRTRE IESFAEQLHE EYQDAGFELG SSNLGAGDEG       180
     EATVAKLLRS LFEDAVQVGA SDIHIEPDEK VLRIRQRIDG ILHENILSEV RIAQALVLRL       240
     KLVAGLDISE KRLPQDGRFN MKVRGRDVDV RMSTMPVQYG ESVVMRLLDQ SSGILSLTET       300
     GMPPEILTRF RRQLKRPHGM ILVTGPTGSG KTTTLYGALS ELNQASQKII TVEDPVEYRL       360
     PRVNQVQVNP KIGLTFSHVL RSTLRQDPDI LLVGEMRDNE TVEIGLRGAI TGHLVLTTLH       420
     TNDAVTSALR LIDMGAPGYL VASALRAVVA QRLVRRVCEH CVEEKAPDEG QATWLTVLSG       480
     EAPGQHVYHK GRGCQSCNFT GYAGRIGVYE LLELDQPMMD SLRRNDAEGF AKAARQHPHY       540
     RPLALTALDY ARQGITSVDE VLRLAEDLG                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page