(data stored in ACNUC7421 zone)

EMBL: CP000462.PE369

CP000462.PE369       Location/Qualifiers
FT   CDS             413051..414271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0393"
FT                   /product="GspF family protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38845"
FT                   /db_xref="GOA:A0KFA0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA0"
FT                   /protein_id="ABK38845.1"
FT                   /translation="MSSFAYKGRDSQGNAVSGVVDAANEMAAAEQLMRRGVMPTELKPG
FT                   KAKAAALDWSLLLERGVRLDELVVFSRQMYALTRAGIPILRAIAGLEESAHSKPLKRAL
FT                   HALGEDLGNGRPLSSSMQAHPRVFSSLFVAIIHVGENTGQLEEAFLQLANYFELELETR
FT                   KRIKTAMRYPSFVLIAIGIAMVILNIMVIPVFAGMFAKFGVELPLATRILLATSHFFVH
FT                   YWWVMLGVLLAMVFGWRRWVSTVKGKLTWHRWQLKLPIVGTIIERSLLARFARSFSMML
FT                   KAGVPLNTALSLVADAVDNAWMAGRIRDMRAGIERGESLLRTAGSSGLFTPLVMQMIAV
FT                   GEETGQVDDLLHEAAEYYEREVDYDLKSLTARIEPILIGIVAVMVLILALGIFTPMWDM
FT                   MRAVRGK"
     MSSFAYKGRD SQGNAVSGVV DAANEMAAAE QLMRRGVMPT ELKPGKAKAA ALDWSLLLER        60
     GVRLDELVVF SRQMYALTRA GIPILRAIAG LEESAHSKPL KRALHALGED LGNGRPLSSS       120
     MQAHPRVFSS LFVAIIHVGE NTGQLEEAFL QLANYFELEL ETRKRIKTAM RYPSFVLIAI       180
     GIAMVILNIM VIPVFAGMFA KFGVELPLAT RILLATSHFF VHYWWVMLGV LLAMVFGWRR       240
     WVSTVKGKLT WHRWQLKLPI VGTIIERSLL ARFARSFSMM LKAGVPLNTA LSLVADAVDN       300
     AWMAGRIRDM RAGIERGESL LRTAGSSGLF TPLVMQMIAV GEETGQVDDL LHEAAEYYER       360
     EVDYDLKSLT ARIEPILIGI VAVMVLILAL GIFTPMWDMM RAVRGK                      406
//

If you have problems or comments...

PBIL Back to PBIL home page