(data stored in ACNUC7421 zone)

EMBL: CP000462.PE37

CP000462.PE37        Location/Qualifiers
FT   CDS             complement(44739..45593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0041"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36516"
FT                   /db_xref="GOA:A0KEC4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC4"
FT                   /protein_id="ABK36516.1"
FT                   /translation="MAADVGDAPAASYEYFDRLEYDSGRFFIRHLLLKFAAFTSLSIQE
FT                   FSAFRIWLSPFRAQDGGLCYNQNTVSLKGTDMAQQGTLYIISSPSGAGKSSLLNALLTQ
FT                   HNSAGKMQLSVSHTTRATRPGEEHGVHYHFVKVEEFKALIERGDFLEWAEVFGNYYGTS
FT                   RAAIEACLAQGIDVFLDIDWQGARQIREQMPTKSIFILPPSREELERRLIGRGQDSAEV
FT                   IKGRMEKAIAEMVHYDEYDYVIINEDFEQALFQLRAVIECQRLELRQQQQAQQNLLQQL
FT                   LAE"
     MAADVGDAPA ASYEYFDRLE YDSGRFFIRH LLLKFAAFTS LSIQEFSAFR IWLSPFRAQD        60
     GGLCYNQNTV SLKGTDMAQQ GTLYIISSPS GAGKSSLLNA LLTQHNSAGK MQLSVSHTTR       120
     ATRPGEEHGV HYHFVKVEEF KALIERGDFL EWAEVFGNYY GTSRAAIEAC LAQGIDVFLD       180
     IDWQGARQIR EQMPTKSIFI LPPSREELER RLIGRGQDSA EVIKGRMEKA IAEMVHYDEY       240
     DYVIINEDFE QALFQLRAVI ECQRLELRQQ QQAQQNLLQQ LLAE                        284
//

If you have problems or comments...

PBIL Back to PBIL home page