(data stored in ACNUC7421 zone)

EMBL: CP000462.PE371

CP000462.PE371       Location/Qualifiers
FT   CDS             414987..415658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0395"
FT                   /product="msha pilin protein mshb"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37751"
FT                   /db_xref="GOA:A0KFA2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA2"
FT                   /protein_id="ABK37751.1"
FT                   /translation="MTTTRLVPRYSGVVSPHRAAGFSLIELVIVIVILGILAVTALPRF
FT                   LDVTDEAKKASVEGVSGGFATGVSLVRAQWEAEGRAKQDSLNTVLYDGSRFYLTTPTDT
FT                   QVSNGELSPGYPMDTSAGGGIDVDPANLTAPRCLKIWEGLLQNPPKATASFSEVRGSGN
FT                   DLKYYVSVTNNGLDSVCRYYLVNSLSKGSDGKYQDPQGSTDAFMSFSYRPASGQVTTNI
FT                   N"
     MTTTRLVPRY SGVVSPHRAA GFSLIELVIV IVILGILAVT ALPRFLDVTD EAKKASVEGV        60
     SGGFATGVSL VRAQWEAEGR AKQDSLNTVL YDGSRFYLTT PTDTQVSNGE LSPGYPMDTS       120
     AGGGIDVDPA NLTAPRCLKI WEGLLQNPPK ATASFSEVRG SGNDLKYYVS VTNNGLDSVC       180
     RYYLVNSLSK GSDGKYQDPQ GSTDAFMSFS YRPASGQVTT NIN                         223
//

If you have problems or comments...

PBIL Back to PBIL home page