(data stored in ACNUC7421 zone)

EMBL: CP000462.PE380

CP000462.PE380       Location/Qualifiers
FT   CDS             425670..427139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0404"
FT                   /product="ribonuclease G"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37871"
FT                   /db_xref="GOA:A0KFB1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB1"
FT                   /protein_id="ABK37871.1"
FT                   /translation="MSVELLVNVTPSETRVALVENGLLQEVHVERQAKRGIVGNIYKGK
FT                   ISRVLPGMQAAFVDIGMDKAAFLHASDIVPHTECVAVKEKEQFQAGNIAELVRQGQDIM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGSAHVGVSQRIESEAERERLKRTVAGYVD
FT                   ELGGYIIRTAAEGVGEQELEQDAAFLKRLWRKILERKQKYPPCKILYEDPSLAFRVVRD
FT                   FVGAELDKIRVDSRQSFDQLKRFTEEYVPELANKLEYYSGESPIFDLYDVENEIQRALE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNVEATAAIARHLRLRNL
FT                   GGIIIIDFIDMQSEDHRRRVLHSLEQALSKDRAKTNVNGFSQLGLVEMTRKRTRESLEH
FT                   VLCSECPECKGRGRVKTVESVCFEILREIIRVNRAYDADQFTVYAAPAVADYLRGEESH
FT                   SLAELEVFIGKQVRVVSEPLCGQEQFDVVMM"
     MSVELLVNVT PSETRVALVE NGLLQEVHVE RQAKRGIVGN IYKGKISRVL PGMQAAFVDI        60
     GMDKAAFLHA SDIVPHTECV AVKEKEQFQA GNIAELVRQG QDIMVQVVKD PLGTKGARLT       120
     TDITLPSRYL VFMPGSAHVG VSQRIESEAE RERLKRTVAG YVDELGGYII RTAAEGVGEQ       180
     ELEQDAAFLK RLWRKILERK QKYPPCKILY EDPSLAFRVV RDFVGAELDK IRVDSRQSFD       240
     QLKRFTEEYV PELANKLEYY SGESPIFDLY DVENEIQRAL ERKVELKSGG YLIIDQTEAM       300
     TTVDINTGAF VGHRNLEETI FNTNVEATAA IARHLRLRNL GGIIIIDFID MQSEDHRRRV       360
     LHSLEQALSK DRAKTNVNGF SQLGLVEMTR KRTRESLEHV LCSECPECKG RGRVKTVESV       420
     CFEILREIIR VNRAYDADQF TVYAAPAVAD YLRGEESHSL AELEVFIGKQ VRVVSEPLCG       480
     QEQFDVVMM                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page