(data stored in ACNUC7421 zone)

EMBL: CP000462.PE381

CP000462.PE381       Location/Qualifiers
FT   CDS             427170..431039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02099"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38887"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB2"
FT                   /protein_id="ABK38887.1"
FT                   /translation="MALGVFFVLLAILVSLVRFGGPLLNQHRQALLNTLLADSKLEASV
FT                   DRIGLDWTQLGPALELQQLVIAPNSGRFALRLGKVWAHLDFWRSLNELKPVFGQLILSD
FT                   GDIALDLGQPAEPETGNGSDQQQALLRFLLTQLSTFDIHDTRLSLTTALGEVRALDIAQ
FT                   LRWQNRGKRHQGVGKAYLINGVGESTLDLIVDVDAPQVRLDRLKGQLYLGARQLDISPM
FT                   LARTHSGEPKVSGQLDFQLWSEFKAGQLGDSLLAFGDNYLIWQDEKQGDLHRLGLQGGK
FT                   IQLRRDGKEWQFASHDVTFKLDGKPWLHSRLQLERVGDRIQGYVPAIDLDQIANLSQLV
FT                   SGIYPELTETLKRTRPTGKIQDLILQADAGWQGLSVSGQLSHIRVNAWHDVPGVRDLNG
FT                   EFWLTPTGGSARLQLANDAIDPARHFKEPIPIDRFSARLDWWQVPQGWVLYGQDLVLDN
FT                   PDLSLASRFRLDLFEHPFLALTGRIDVKNAANADRYYPLQVMDKSLVDYLSGAIKGGKA
FT                   KGADLLWYGEFRDFPYRKGEGIFQVAVPLQQASYEFFPGWQPLTDLQIDLLFQNASLDM
FT                   NSRATQLGKASSDSVHAWIPDLYPGAHLYVDAKVEGEGKAISDYLQDSPLGGSVGQALR
FT                   EVEIRGPMKGSVKLDIPLDGESEVKASGDALFSNNKVRVTSLDLPLEQVQGRLEYDNEQ
FT                   TRFSNLKASLWNQPLTLDYQGRQQPNRYQVDLKFKGQWDSRRQRQDIPALDILKGRGNW
FT                   AGSLGLTLPGDQPFSFQLALDSNLQGMGLDLPAPLAKAAGSRLPLKVTARGRDGSADIR
FT                   AVLGADVDMQSRLVYGDGVPYLSRVRVDVGQPGARVLRDRPMLLAINQQQADVAGWLAR
FT                   LKQWLPASTAPSGNAVVGPSFLPQEWWVDGRLARADIGSANLKAVHFTVGPVNQATEVM
FT                   IDSPDVMGVVRLPVSERQPIDAKFARIHWSGKSSDLSPDPDARQDRAIMDAIPWLTFSC
FT                   VDCRFGELPLGEVKGELIPGADKLSLKGLEMRLAGSQLNGSAEWLAGADGMQTRARAHI
FT                   SSNNSELLLKRLGYTSPIGDAPGKMALDLSWRDVPYRPNVPTLSGTADYQLEGGTLREV
FT                   NDKGARLLSLLSLDSLLRKLRLDFRDVFDKGFYFESMSASAKIKQGVVDNRDFYMKGAA
FT                   GNLRGEGIADLVRWRLDYELSFSPNLGGTLPVVAAFSLTPITGLYVLALSKLLEPVVDV
FT                   VTRIDFRVSGPLDDPKLIEAGRDRARIKLNQQQKEAVDAVAPNLPTQEVTPFLLTPKHA
FT                   GPAQR"
     MALGVFFVLL AILVSLVRFG GPLLNQHRQA LLNTLLADSK LEASVDRIGL DWTQLGPALE        60
     LQQLVIAPNS GRFALRLGKV WAHLDFWRSL NELKPVFGQL ILSDGDIALD LGQPAEPETG       120
     NGSDQQQALL RFLLTQLSTF DIHDTRLSLT TALGEVRALD IAQLRWQNRG KRHQGVGKAY       180
     LINGVGESTL DLIVDVDAPQ VRLDRLKGQL YLGARQLDIS PMLARTHSGE PKVSGQLDFQ       240
     LWSEFKAGQL GDSLLAFGDN YLIWQDEKQG DLHRLGLQGG KIQLRRDGKE WQFASHDVTF       300
     KLDGKPWLHS RLQLERVGDR IQGYVPAIDL DQIANLSQLV SGIYPELTET LKRTRPTGKI       360
     QDLILQADAG WQGLSVSGQL SHIRVNAWHD VPGVRDLNGE FWLTPTGGSA RLQLANDAID       420
     PARHFKEPIP IDRFSARLDW WQVPQGWVLY GQDLVLDNPD LSLASRFRLD LFEHPFLALT       480
     GRIDVKNAAN ADRYYPLQVM DKSLVDYLSG AIKGGKAKGA DLLWYGEFRD FPYRKGEGIF       540
     QVAVPLQQAS YEFFPGWQPL TDLQIDLLFQ NASLDMNSRA TQLGKASSDS VHAWIPDLYP       600
     GAHLYVDAKV EGEGKAISDY LQDSPLGGSV GQALREVEIR GPMKGSVKLD IPLDGESEVK       660
     ASGDALFSNN KVRVTSLDLP LEQVQGRLEY DNEQTRFSNL KASLWNQPLT LDYQGRQQPN       720
     RYQVDLKFKG QWDSRRQRQD IPALDILKGR GNWAGSLGLT LPGDQPFSFQ LALDSNLQGM       780
     GLDLPAPLAK AAGSRLPLKV TARGRDGSAD IRAVLGADVD MQSRLVYGDG VPYLSRVRVD       840
     VGQPGARVLR DRPMLLAINQ QQADVAGWLA RLKQWLPAST APSGNAVVGP SFLPQEWWVD       900
     GRLARADIGS ANLKAVHFTV GPVNQATEVM IDSPDVMGVV RLPVSERQPI DAKFARIHWS       960
     GKSSDLSPDP DARQDRAIMD AIPWLTFSCV DCRFGELPLG EVKGELIPGA DKLSLKGLEM      1020
     RLAGSQLNGS AEWLAGADGM QTRARAHISS NNSELLLKRL GYTSPIGDAP GKMALDLSWR      1080
     DVPYRPNVPT LSGTADYQLE GGTLREVNDK GARLLSLLSL DSLLRKLRLD FRDVFDKGFY      1140
     FESMSASAKI KQGVVDNRDF YMKGAAGNLR GEGIADLVRW RLDYELSFSP NLGGTLPVVA      1200
     AFSLTPITGL YVLALSKLLE PVVDVVTRID FRVSGPLDDP KLIEAGRDRA RIKLNQQQKE      1260
     AVDAVAPNLP TQEVTPFLLT PKHAGPAQR                                        1289
//

If you have problems or comments...

PBIL Back to PBIL home page