(data stored in ACNUC7421 zone)

EMBL: CP000462.PE382

CP000462.PE382       Location/Qualifiers
FT   CDS             431074..431394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0406"
FT                   /product="stress responsive A/B Barrel Domain superfamily"
FT                   /note="identified by match to protein family HMM PF07876"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39490"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB3"
FT                   /protein_id="ABK39490.1"
FT                   /translation="MIRHILLIAFKPGTQPAQIDAVRAAFLAIPHQVSGVLAVEWGRDD
FT                   SPEGRAEGFTHSVLMTFADEAARQRYLPHPDHDALKAIFRPVLERIIVLDYTLQAGDAV
FT                   SI"
     MIRHILLIAF KPGTQPAQID AVRAAFLAIP HQVSGVLAVE WGRDDSPEGR AEGFTHSVLM        60
     TFADEAARQR YLPHPDHDAL KAIFRPVLER IIVLDYTLQA GDAVSI                      106
//

If you have problems or comments...

PBIL Back to PBIL home page