(data stored in ACNUC7421 zone)

EMBL: CP000462.PE385

CP000462.PE385       Location/Qualifiers
FT   CDS             433861..434721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0409"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37300"
FT                   /db_xref="GOA:A0KFB6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB6"
FT                   /protein_id="ABK37300.1"
FT                   /translation="MLTLSKISNIRSQLSPSELKIADYILACPEQVTHFSSQELAQQAD
FT                   VSQSSIVKFTQKIGFKGFTAFKLAVSEDLGRKHAIKTDNVGDLYNGIGRDDDLETMAKK
FT                   LAQEKINSIVETTQALDNATLARVLDVINQAGRVQLVGIGGSALTAKDLWYKLLKIGVT
FT                   TLFAQDSHVQISIAQTLGPGDVQLVVSYSGASRDVLAAAELAKRNGATLIAVTSFRNTP
FT                   LRQMADMVLDTVADENELRISSISSRTAQNTITDILFLGLVQRRDEAWALIDGTRGAID
FT                   RLNKE"
     MLTLSKISNI RSQLSPSELK IADYILACPE QVTHFSSQEL AQQADVSQSS IVKFTQKIGF        60
     KGFTAFKLAV SEDLGRKHAI KTDNVGDLYN GIGRDDDLET MAKKLAQEKI NSIVETTQAL       120
     DNATLARVLD VINQAGRVQL VGIGGSALTA KDLWYKLLKI GVTTLFAQDS HVQISIAQTL       180
     GPGDVQLVVS YSGASRDVLA AAELAKRNGA TLIAVTSFRN TPLRQMADMV LDTVADENEL       240
     RISSISSRTA QNTITDILFL GLVQRRDEAW ALIDGTRGAI DRLNKE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page