(data stored in ACNUC7421 zone)

EMBL: CP000462.PE388

CP000462.PE388       Location/Qualifiers
FT   CDS             complement(436639..438093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0412"
FT                   /product="PTS system, IIBC components"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35861"
FT                   /db_xref="GOA:A0KFB9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB9"
FT                   /protein_id="ABK35861.1"
FT                   /translation="MAKITDTMVGQLIQAIGGRDNITHCGHCMTRLRLSLADSLHADRD
FT                   TIKRIAGVMGVIESDDQFQIVLGPGKAQTACELMNGMLSAGLGALEAPTAQSADLGEIA
FT                   AAKKQALKQKQTSAAHRFLAKFATIFTPLIPGFIAAGLLLGFATLIEQTLLLEGQQAGG
FT                   MLAEFVGYMKLFSKGLFSFLSILIGYNAQKAFGGSGVNGAILASLFVMGYDPQATSGIY
FT                   AGVSDFFGHQIDPRGNIIGVLIACIIGASVERQVRRFIPDSLDMILTSGITLLIMGAVT
FT                   FVLIMPLGVQLYNGMSWLFIHLNGNPFGTAILAGLFLISVMFGIHQGFVPVYFALMDAQ
FT                   GFNSLFPILALAGAGQVGAALALYSRAGKDSLLRTQVKGTIIPGILGVGEPLIYGVTLP
FT                   RVKPFITACCGGALGGFLVGLISWLGLPVGLNTVFGPSGIVALPLMTSAQGIFPGMLVY
FT                   AAGLAVAYLGGYLITLMFGCKNVDLS"
     MAKITDTMVG QLIQAIGGRD NITHCGHCMT RLRLSLADSL HADRDTIKRI AGVMGVIESD        60
     DQFQIVLGPG KAQTACELMN GMLSAGLGAL EAPTAQSADL GEIAAAKKQA LKQKQTSAAH       120
     RFLAKFATIF TPLIPGFIAA GLLLGFATLI EQTLLLEGQQ AGGMLAEFVG YMKLFSKGLF       180
     SFLSILIGYN AQKAFGGSGV NGAILASLFV MGYDPQATSG IYAGVSDFFG HQIDPRGNII       240
     GVLIACIIGA SVERQVRRFI PDSLDMILTS GITLLIMGAV TFVLIMPLGV QLYNGMSWLF       300
     IHLNGNPFGT AILAGLFLIS VMFGIHQGFV PVYFALMDAQ GFNSLFPILA LAGAGQVGAA       360
     LALYSRAGKD SLLRTQVKGT IIPGILGVGE PLIYGVTLPR VKPFITACCG GALGGFLVGL       420
     ISWLGLPVGL NTVFGPSGIV ALPLMTSAQG IFPGMLVYAA GLAVAYLGGY LITLMFGCKN       480
     VDLS                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page