(data stored in ACNUC7421 zone)

EMBL: CP000462.PE389

CP000462.PE389       Location/Qualifiers
FT   CDS             complement(438193..439089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0413"
FT                   /product="putative glucokinase regulator homolog"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM TIGR00274"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36652"
FT                   /db_xref="GOA:A0KFC0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFC0"
FT                   /protein_id="ABK36652.1"
FT                   /translation="MTIDLSSMITETRNPASVEIDQLPTLEMLRVINQEDQQVALAVSQ
FT                   LLPEITRAVDAIAAAFGKGGRLVYIGAGTSGRLGILDASECPPTYGVSAEQVVGLIAGG
FT                   HKAILQAVENAEDDAELGAQDLKNIQFCANDVLVGIAASGRTPYVLGAMAHARAVGATV
FT                   CSISCNPGSPLAQAADISMVAVVGPEIVTGSSRMKAGTAQKLILNMLSTGAMIRTGKVY
FT                   GNLMVDVEATNAKLVERQKRIVMEATDCERAVAERALAQADNHCKTAIVMILAGLTADE
FT                   ARTRLQSSNGFISQCTH"
     MTIDLSSMIT ETRNPASVEI DQLPTLEMLR VINQEDQQVA LAVSQLLPEI TRAVDAIAAA        60
     FGKGGRLVYI GAGTSGRLGI LDASECPPTY GVSAEQVVGL IAGGHKAILQ AVENAEDDAE       120
     LGAQDLKNIQ FCANDVLVGI AASGRTPYVL GAMAHARAVG ATVCSISCNP GSPLAQAADI       180
     SMVAVVGPEI VTGSSRMKAG TAQKLILNML STGAMIRTGK VYGNLMVDVE ATNAKLVERQ       240
     KRIVMEATDC ERAVAERALA QADNHCKTAI VMILAGLTAD EARTRLQSSN GFISQCTH         298
//

If you have problems or comments...

PBIL Back to PBIL home page