(data stored in ACNUC7421 zone)

EMBL: CP000462.PE392

CP000462.PE392       Location/Qualifiers
FT   CDS             complement(440568..441884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0416"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38737"
FT                   /db_xref="GOA:A0KFC3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC3"
FT                   /protein_id="ABK38737.1"
FT                   /translation="MTTVTPAYDHSRPLNRQDYKTLSLAALGGALEFYDFIIFVFFAVV
FT                   IGELFFPADIPEWLRQFQTFGIFAAGYLARPLGGIIMAHFGDLIGRKRMFTLSILLMAL
FT                   PTLLIGLLPTYATLGIAAPLLLLLLRILQGAAIGGEVPGAWVFVAEHVPARRVGVACGT
FT                   LTAGLTAGILLGSLVATAINRGMSPSEVSDWGWRLAFVLGGAFGIVAMYLRRWLHETPV
FT                   FAEMQANKALAEELPLKTVLRSHKGSVVVSMLLTWLLSAGIVVVILMTPTYLQKVHGIS
FT                   PADALTANSLAILALTFGCIVYGRLIDALGSGPTFMLGSLLLAGASYAFYHGLATDTSQ
FT                   LVPLYALAGFSVGIVGAVPYVMVNAFPAVVRFSGLSFSYNVAYAIFGGLTPMLVTLWMK
FT                   EDVLAPSHYVVSLAALGFVLGLLLWLQQRSQRQSAPQAA"
     MTTVTPAYDH SRPLNRQDYK TLSLAALGGA LEFYDFIIFV FFAVVIGELF FPADIPEWLR        60
     QFQTFGIFAA GYLARPLGGI IMAHFGDLIG RKRMFTLSIL LMALPTLLIG LLPTYATLGI       120
     AAPLLLLLLR ILQGAAIGGE VPGAWVFVAE HVPARRVGVA CGTLTAGLTA GILLGSLVAT       180
     AINRGMSPSE VSDWGWRLAF VLGGAFGIVA MYLRRWLHET PVFAEMQANK ALAEELPLKT       240
     VLRSHKGSVV VSMLLTWLLS AGIVVVILMT PTYLQKVHGI SPADALTANS LAILALTFGC       300
     IVYGRLIDAL GSGPTFMLGS LLLAGASYAF YHGLATDTSQ LVPLYALAGF SVGIVGAVPY       360
     VMVNAFPAVV RFSGLSFSYN VAYAIFGGLT PMLVTLWMKE DVLAPSHYVV SLAALGFVLG       420
     LLLWLQQRSQ RQSAPQAA                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page