(data stored in ACNUC7421 zone)

EMBL: CP000462.PE393

CP000462.PE393       Location/Qualifiers
FT   CDS             442132..442803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0418"
FT                   /product="domain of unknown function DUF71"
FT                   /note="identified by match to protein family HMM PF01902"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38452"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC4"
FT                   /protein_id="ABK38452.1"
FT                   /translation="MKTKVLLSWSSGKDSAWALHALRQDPAIEVVGLFTTLNQAFERVA
FT                   MHGVRKQLLLAQAECVGLPLTTIDLPWPCSNEDYARIMTDFIADVVAQGIRHMAFGDLF
FT                   LEDVRAYRERQLAGTGITPLFPLWGSKTDELAGEMMAAGLRARISTLDPRKLPATLGGH
FT                   EFDGALLAALPAGVDPCGENGEFHTLAWDGPMFQRPLAIRVGETVERDGFVFTDLLPAT
FT                   I"
     MKTKVLLSWS SGKDSAWALH ALRQDPAIEV VGLFTTLNQA FERVAMHGVR KQLLLAQAEC        60
     VGLPLTTIDL PWPCSNEDYA RIMTDFIADV VAQGIRHMAF GDLFLEDVRA YRERQLAGTG       120
     ITPLFPLWGS KTDELAGEMM AAGLRARIST LDPRKLPATL GGHEFDGALL AALPAGVDPC       180
     GENGEFHTLA WDGPMFQRPL AIRVGETVER DGFVFTDLLP ATI                         223
//

If you have problems or comments...

PBIL Back to PBIL home page