(data stored in ACNUC7421 zone)

EMBL: CP000462.PE394

CP000462.PE394       Location/Qualifiers
FT   CDS             complement(442800..444002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0417"
FT                   /product="regulatory components of sensory transduction
FT                   system"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39902"
FT                   /db_xref="GOA:A0KFC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC5"
FT                   /protein_id="ABK39902.1"
FT                   /translation="MPWHICNKSGPSGPICSTKSEATIMLNLLDPDTKPTLLVVDDTPE
FT                   NLSLLSALLSPHYRVKVAISGQRALEILSAGTRVDLILLDVVMPQMDGYQVMQALQEMP
FT                   QAREIPVIFLTAKVEESAEAHGLALGAVDYIHKPITPAIVLARVRNHLELKAARDLLHD
FT                   QNAFLEQEVERRTRENELIQNITIHSLASLAETRDNETGNHILRTQHYVRLLAETLCEH
FT                   PRFRAELTPKTIDLLFKSAPLHDIGKVGVPDRILLKPGKLDADEFAQMKHHSILGKEAI
FT                   VHAEEALGVEVEFLRLAKEIACYHHEKWDGTGYPYGLIGDEIPLSARLMALADVYDALI
FT                   SKRCYKAAMSHQEVVPIILAGRGNHFDPDITDAFARIHQQFHEIALRYNDDKGERESNR
FT                   D"
     MPWHICNKSG PSGPICSTKS EATIMLNLLD PDTKPTLLVV DDTPENLSLL SALLSPHYRV        60
     KVAISGQRAL EILSAGTRVD LILLDVVMPQ MDGYQVMQAL QEMPQAREIP VIFLTAKVEE       120
     SAEAHGLALG AVDYIHKPIT PAIVLARVRN HLELKAARDL LHDQNAFLEQ EVERRTRENE       180
     LIQNITIHSL ASLAETRDNE TGNHILRTQH YVRLLAETLC EHPRFRAELT PKTIDLLFKS       240
     APLHDIGKVG VPDRILLKPG KLDADEFAQM KHHSILGKEA IVHAEEALGV EVEFLRLAKE       300
     IACYHHEKWD GTGYPYGLIG DEIPLSARLM ALADVYDALI SKRCYKAAMS HQEVVPIILA       360
     GRGNHFDPDI TDAFARIHQQ FHEIALRYND DKGERESNRD                             400
//

If you have problems or comments...

PBIL Back to PBIL home page