(data stored in ACNUC7421 zone)

EMBL: CP000462.PE395

CP000462.PE395       Location/Qualifiers
FT   CDS             complement(443941..446607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0419"
FT                   /product="hybrid sensory kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36886"
FT                   /db_xref="GOA:A0KFC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC6"
FT                   /protein_id="ABK36886.1"
FT                   /translation="MRQLIGETLLSGPAAALTARRKVIQVLTCLDRSPTFVAPLAGATS
FT                   ELVRQLVANAEPLQLQVWLEPHAQELWLSLSANAPISPEPDGRHSRGIRLVAHADNAIA
FT                   LVYRLPRWPDEPLLQQMQRQFAEPTRDELFAVMQAKNQELEVAYELAEGATRAKSDFLA
FT                   NMSHEIRTPMNAILGMSHLALQTRLDPQQFDYVSKIQRSAQHLLGIINDILDFSKIEAG
FT                   KLDLERIEFDLDHVLENLATLVGEKAEAKGIELLFEVDHQLDTLLYGDPLRLGQILINY
FT                   ANNAVKFTEQGEILVKVSCLEKQPQEVLLHCSVQDTGIGMSQEQQQRLFQSFQQADSST
FT                   TRKYGGTGLGLAISRKLAELMGGEVGVQSEPGRGSTFWFTARLGRGRRRSRYLPSLDLR
FT                   GRRMLVADDSASARTIMAALLRSMSFVVDTAESGQQALQMIAGAEQEGQPYEVVLLDWH
FT                   MPGLDGIETGRRLIARGMGQRPYRVMVTGYGREEVFRQADTAGFDRVLVKPVCASVLFD
FT                   TVIGLFGQQASPLTFKPPQATHHYRFDGLRILLAEDNELNQQVALELLRAVGADVSIAG
FT                   NGAIALEMVAQTHYDLILMDMQMPVMDGLAATRLLREREDVGQHTPILAMTANVMAGDR
FT                   ERCLAAGMDDHIAKPIDPDRLYAALQRWATSFSREVSSRLTASRASPATALLPQLRALG
FT                   LNAETALQRLMHNWEWYRDLLQRFARQGSQPMETLLAALQANDREEAHRQAHTLKGIAA
FT                   TLGAGSLQELSARLESALARGDDAASLLPLAELGLQQQQQLAAGLLTLLPAPAAAGLPE
FT                   ATPAELAPLLHQLTGLLLEDDAEAFILFQRNQARLAPLLGEAAPAMHDAMTRFRFADAL
FT                   AHLQQVRALRPDLFNQE"
     MRQLIGETLL SGPAAALTAR RKVIQVLTCL DRSPTFVAPL AGATSELVRQ LVANAEPLQL        60
     QVWLEPHAQE LWLSLSANAP ISPEPDGRHS RGIRLVAHAD NAIALVYRLP RWPDEPLLQQ       120
     MQRQFAEPTR DELFAVMQAK NQELEVAYEL AEGATRAKSD FLANMSHEIR TPMNAILGMS       180
     HLALQTRLDP QQFDYVSKIQ RSAQHLLGII NDILDFSKIE AGKLDLERIE FDLDHVLENL       240
     ATLVGEKAEA KGIELLFEVD HQLDTLLYGD PLRLGQILIN YANNAVKFTE QGEILVKVSC       300
     LEKQPQEVLL HCSVQDTGIG MSQEQQQRLF QSFQQADSST TRKYGGTGLG LAISRKLAEL       360
     MGGEVGVQSE PGRGSTFWFT ARLGRGRRRS RYLPSLDLRG RRMLVADDSA SARTIMAALL       420
     RSMSFVVDTA ESGQQALQMI AGAEQEGQPY EVVLLDWHMP GLDGIETGRR LIARGMGQRP       480
     YRVMVTGYGR EEVFRQADTA GFDRVLVKPV CASVLFDTVI GLFGQQASPL TFKPPQATHH       540
     YRFDGLRILL AEDNELNQQV ALELLRAVGA DVSIAGNGAI ALEMVAQTHY DLILMDMQMP       600
     VMDGLAATRL LREREDVGQH TPILAMTANV MAGDRERCLA AGMDDHIAKP IDPDRLYAAL       660
     QRWATSFSRE VSSRLTASRA SPATALLPQL RALGLNAETA LQRLMHNWEW YRDLLQRFAR       720
     QGSQPMETLL AALQANDREE AHRQAHTLKG IAATLGAGSL QELSARLESA LARGDDAASL       780
     LPLAELGLQQ QQQLAAGLLT LLPAPAAAGL PEATPAELAP LLHQLTGLLL EDDAEAFILF       840
     QRNQARLAPL LGEAAPAMHD AMTRFRFADA LAHLQQVRAL RPDLFNQE                    888
//

If you have problems or comments...

PBIL Back to PBIL home page