(data stored in ACNUC7421 zone)

EMBL: CP000462.PE396

CP000462.PE396       Location/Qualifiers
FT   CDS             complement(446608..447678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0420"
FT                   /product="TorS-related protein"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37498"
FT                   /db_xref="GOA:A0KFC7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC7"
FT                   /protein_id="ABK37498.1"
FT                   /translation="MQLEQSVLEASYPLRHDIDLHLTVMAVRRLPFIANLSEVDRAMLS
FT                   TVVSELGSNILKYAERGEITLTLHHPRGRPCIDIVARDQGPGIGDVHQAMQDHYSTSGT
FT                   LGLGLPGVRRMMSELTISTPPEGGTLVQARKWLGAAPLVSRPIAPLASAGQLHAGLQLA
FT                   WASENRPCYPERVSGDLAFIRPGPEGVSLILIDVSGHGASANKLVQVLEAALQQTHEQE
FT                   PARLLQLLHQHCIGTRGAAAGVALVNGERGELSYAGIGNTRICLRGREPWRGISRDGVL
FT                   GERFPTPLLQRQPLVAGDVVMLYSDGISESLNLRDGALDLAAEPAQLARQVIAHSGRST
FT                   DDASCIVLRVLAGEED"
     MQLEQSVLEA SYPLRHDIDL HLTVMAVRRL PFIANLSEVD RAMLSTVVSE LGSNILKYAE        60
     RGEITLTLHH PRGRPCIDIV ARDQGPGIGD VHQAMQDHYS TSGTLGLGLP GVRRMMSELT       120
     ISTPPEGGTL VQARKWLGAA PLVSRPIAPL ASAGQLHAGL QLAWASENRP CYPERVSGDL       180
     AFIRPGPEGV SLILIDVSGH GASANKLVQV LEAALQQTHE QEPARLLQLL HQHCIGTRGA       240
     AAGVALVNGE RGELSYAGIG NTRICLRGRE PWRGISRDGV LGERFPTPLL QRQPLVAGDV       300
     VMLYSDGISE SLNLRDGALD LAAEPAQLAR QVIAHSGRST DDASCIVLRV LAGEED           356
//

If you have problems or comments...

PBIL Back to PBIL home page