(data stored in ACNUC7421 zone)

EMBL: CP000462.PE399

CP000462.PE399       Location/Qualifiers
FT   CDS             449431..450123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0424"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37878"
FT                   /db_xref="GOA:A0KFD0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD0"
FT                   /protein_id="ABK37878.1"
FT                   /translation="MNLWYRDYPQGALTALHCHGGSQFCYLHRGGGVISSQAAGVLLVA
FT                   GQLCLIPAGLAHEFRVLRHSRLSLIYLDDLDGGSELTTRQVSPLLAGLFERLADMAEPG
FT                   LRDAYLTVLAAELRQAPVAAGFMLSAALDVRLLRVLERVCRHPSIEYGLAELAADSGAS
FT                   VRTLNRLFSQQLGCSFRQWRQQVVMGRARQLQQQGQPLSRIALELGYGDFSAFSHAFNR
FT                   FLREPAGP"
     MNLWYRDYPQ GALTALHCHG GSQFCYLHRG GGVISSQAAG VLLVAGQLCL IPAGLAHEFR        60
     VLRHSRLSLI YLDDLDGGSE LTTRQVSPLL AGLFERLADM AEPGLRDAYL TVLAAELRQA       120
     PVAAGFMLSA ALDVRLLRVL ERVCRHPSIE YGLAELAADS GASVRTLNRL FSQQLGCSFR       180
     QWRQQVVMGR ARQLQQQGQP LSRIALELGY GDFSAFSHAF NRFLREPAGP                  230
//

If you have problems or comments...

PBIL Back to PBIL home page