(data stored in ACNUC7421 zone)

EMBL: CP000462.PE40

CP000462.PE40        Location/Qualifiers
FT   CDS             47729..48535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0044"
FT                   /product="sensory box/GGDEF family protein, putative"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38895"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC8"
FT                   /protein_id="ABK38895.1"
FT                   /translation="MADAIALLEAGLWSWSPQQGVQRDLSCLRLLGLNEAGLDDLGWLE
FT                   RVHPDDVGNLQEALTACQSGRVAQIRLEYRILHHDGHYVRLEERARRDVHGQVLGVVCL
FT                   LDSQTLPVEERNGTDPLTGLESRSHFELLLDERLASESGSFSLLQFSVDHRAKIQQLFG
FT                   EVACDAMLAKLARIVRHELRREDPFARWDEDGFILMLSQTDRLSGLEIAERLRLEIADA
FT                   SLLPQRPVTVSIGLVQSQAGEQIDHLLARLATCHGQARREHNTVVG"
     MADAIALLEA GLWSWSPQQG VQRDLSCLRL LGLNEAGLDD LGWLERVHPD DVGNLQEALT        60
     ACQSGRVAQI RLEYRILHHD GHYVRLEERA RRDVHGQVLG VVCLLDSQTL PVEERNGTDP       120
     LTGLESRSHF ELLLDERLAS ESGSFSLLQF SVDHRAKIQQ LFGEVACDAM LAKLARIVRH       180
     ELRREDPFAR WDEDGFILML SQTDRLSGLE IAERLRLEIA DASLLPQRPV TVSIGLVQSQ       240
     AGEQIDHLLA RLATCHGQAR REHNTVVG                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page