(data stored in ACNUC7421 zone)

EMBL: CP000462.PE402

CP000462.PE402       Location/Qualifiers
FT   CDS             complement(451497..452342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0426"
FT                   /product="zinc protease"
FT                   /note="identified by match to protein family HMM PF04228"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38453"
FT                   /db_xref="GOA:A0KFD3"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD3"
FT                   /protein_id="ABK38453.1"
FT                   /translation="MRWQDRRESNNVEDRRQQGSGGGIPIGGKGRLILLVVVMVAGYYG
FT                   VDLSPLLSEPTTQSQPQRQEMSQPAKDPLARFTSVMLASTEDAWGEIFQQSGSRYQAPK
FT                   LVLYRGATRTGCGQGQSVMGPFYCPADRTVYIDLSFYQEMRDKLGADGDFAQGYVVAHE
FT                   VGHHVQNLLGIERKIREQQQGLSRAEQNKLSVKLELQADCFAGVWGHYMQQEQVLEHGD
FT                   LEEALNAAQAIGDDRLQQQSQGRVIPDSFTHGSSAQRYAWFKRGFDSGKPASCNTFAAR
FT                   "
     MRWQDRRESN NVEDRRQQGS GGGIPIGGKG RLILLVVVMV AGYYGVDLSP LLSEPTTQSQ        60
     PQRQEMSQPA KDPLARFTSV MLASTEDAWG EIFQQSGSRY QAPKLVLYRG ATRTGCGQGQ       120
     SVMGPFYCPA DRTVYIDLSF YQEMRDKLGA DGDFAQGYVV AHEVGHHVQN LLGIERKIRE       180
     QQQGLSRAEQ NKLSVKLELQ ADCFAGVWGH YMQQEQVLEH GDLEEALNAA QAIGDDRLQQ       240
     QSQGRVIPDS FTHGSSAQRY AWFKRGFDSG KPASCNTFAA R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page