(data stored in ACNUC7421 zone)

EMBL: CP000462.PE403

CP000462.PE403       Location/Qualifiers
FT   CDS             complement(452450..452713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36698"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD4"
FT                   /protein_id="ABK36698.1"
FT                   /translation="MSEPTEFFDEQTLLEMVDNQLSDGHPLQVKATLMRLVMKGTPREE
FT                   TLQYIACALGAELMAMEADQGPFNLERYGQFLDSLPEMPWAE"
     MSEPTEFFDE QTLLEMVDNQ LSDGHPLQVK ATLMRLVMKG TPREETLQYI ACALGAELMA        60
     MEADQGPFNL ERYGQFLDSL PEMPWAE                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page