(data stored in ACNUC7421 zone)

EMBL: CP000462.PE409

CP000462.PE409       Location/Qualifiers
FT   CDS             460466..461422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0433"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="identified by match to protein family HMM PF02655;
FT                   match to protein family HMM TIGR00768"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38151"
FT                   /db_xref="GOA:A0KFE0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFE0"
FT                   /protein_id="ABK38151.1"
FT                   /translation="MAPYTLPPHPAQALPSSGIVMKIAILSREPNNYSTRRLVEVAQAR
FT                   GHQVEVLDTLRCYMNIASHNPSIHYEGRELESYDAVIPRIGASITFYGTAVLRQFEMMN
FT                   TMALNSSVAISRSRDKLRAMQLLSRHGIGLPVTGYAHSTHDVPDLITMVGGAPLVVKLL
FT                   EGTQGIGVVLCETQKAAESVIEAFIQTNNNILVQEYIREANGADIRCLVVNGKVVAAMR
FT                   RQAQPGEFRSNLHRGGTAEAIKISPEERATAVQAAKIMGLDVAGVDILRSARGPLVLEV
FT                   NSSPGLQGVEAASGKDVAGKIIEFLELKASRKHKPAE"
     MAPYTLPPHP AQALPSSGIV MKIAILSREP NNYSTRRLVE VAQARGHQVE VLDTLRCYMN        60
     IASHNPSIHY EGRELESYDA VIPRIGASIT FYGTAVLRQF EMMNTMALNS SVAISRSRDK       120
     LRAMQLLSRH GIGLPVTGYA HSTHDVPDLI TMVGGAPLVV KLLEGTQGIG VVLCETQKAA       180
     ESVIEAFIQT NNNILVQEYI REANGADIRC LVVNGKVVAA MRRQAQPGEF RSNLHRGGTA       240
     EAIKISPEER ATAVQAAKIM GLDVAGVDIL RSARGPLVLE VNSSPGLQGV EAASGKDVAG       300
     KIIEFLELKA SRKHKPAE                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page