(data stored in ACNUC7421 zone)

EMBL: CP000462.PE413

CP000462.PE413       Location/Qualifiers
FT   CDS             465736..466215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35842"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE4"
FT                   /protein_id="ABK35842.1"
FT                   /translation="MTRTSLLLLTLPLCALAADGELWLVELEHNDGLRLQFQGAELELG
FT                   NAALSGVAGNDELRPGMRLAILSRDGVAERIGMADAIAGFLPTSQWRRAEASLLAVTGR
FT                   ALRLQGLGVLAFDDDTRWLNGSPADLQPGRKLVLSRNEQGCLTEILIANPEDEPE"
     MTRTSLLLLT LPLCALAADG ELWLVELEHN DGLRLQFQGA ELELGNAALS GVAGNDELRP        60
     GMRLAILSRD GVAERIGMAD AIAGFLPTSQ WRRAEASLLA VTGRALRLQG LGVLAFDDDT       120
     RWLNGSPADL QPGRKLVLSR NEQGCLTEIL IANPEDEPE                              159
//

If you have problems or comments...

PBIL Back to PBIL home page