(data stored in ACNUC7421 zone)

EMBL: CP000462.PE415

CP000462.PE415       Location/Qualifiers
FT   CDS             468494..470485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0439"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39508"
FT                   /db_xref="GOA:A0KFE6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE6"
FT                   /protein_id="ABK39508.1"
FT                   /translation="MSTNVSDTAKSSRREQRSSAQTFIDNLKGMAHPNSRRIFIEGSRA
FT                   DIRVPLREIQLADTFVGGTKEAPQFEPNEPVPVYDTSGRYGEEGVAIDVRRGLPRLRED
FT                   WVLERADTEALEGLSSTFTQERLADEGLDHLRFEHLPSARRAKPGRRVTQLHYARTGIV
FT                   TPEMEFIALRENMGRERVRSELLRTQHPGQGFGARLPQNITPEFVRDEVAAGRAIIPSN
FT                   INHPEAEPMIIGRNFLVKINANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYI
FT                   HETREWILRNSPVPIGTVPIYQALEKTNGIAEDLTWELFRDTLLEQAEQGVDYFTIHAG
FT                   VLLRFVPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYQHFREICEICAAYDVALSLGD
FT                   GLRPGSVYDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMHMIERNMTEQLEH
FT                   CHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWYGCAMLCYVTPKEHLGLPNKEDVKQ
FT                   GLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPDTARAYHDETLP
FT                   QESGKVAHFCSMCGPKFCSMKITQDVRDYAAKLEAVEIKMVGMDGQQERVVAEVESGMA
FT                   RMAETFKETGGEIYHQAAALKQAAGEEA"
     MSTNVSDTAK SSRREQRSSA QTFIDNLKGM AHPNSRRIFI EGSRADIRVP LREIQLADTF        60
     VGGTKEAPQF EPNEPVPVYD TSGRYGEEGV AIDVRRGLPR LREDWVLERA DTEALEGLSS       120
     TFTQERLADE GLDHLRFEHL PSARRAKPGR RVTQLHYART GIVTPEMEFI ALRENMGRER       180
     VRSELLRTQH PGQGFGARLP QNITPEFVRD EVAAGRAIIP SNINHPEAEP MIIGRNFLVK       240
     INANIGNSAV TSSIEEEVEK LVWSTRWGAD TVMDLSTGRY IHETREWILR NSPVPIGTVP       300
     IYQALEKTNG IAEDLTWELF RDTLLEQAEQ GVDYFTIHAG VLLRFVPMTA KRLTGIVSRG       360
     GSIMAKWCLS HHKENFLYQH FREICEICAA YDVALSLGDG LRPGSVYDAN DEAQFAELHT       420
     LGELTKIAWE YDVQVMIEGP GHVPMHMIER NMTEQLEHCH EAPFYTLGPL TTDIAPGYDH       480
     FTSGIGAAMI GWYGCAMLCY VTPKEHLGLP NKEDVKQGLI TYKIAAHAAD LAKGHPGAQI       540
     RDNAMSKARF EFRWEDQFNL ALDPDTARAY HDETLPQESG KVAHFCSMCG PKFCSMKITQ       600
     DVRDYAAKLE AVEIKMVGMD GQQERVVAEV ESGMARMAET FKETGGEIYH QAAALKQAAG       660
     EEA                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page