(data stored in ACNUC7421 zone)

EMBL: CP000462.PE416

CP000462.PE416       Location/Qualifiers
FT   CDS             470482..472098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0440"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00097; match to protein
FT                   family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38267"
FT                   /db_xref="GOA:A0KFE7"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE7"
FT                   /protein_id="ABK38267.1"
FT                   /translation="MSSASGAVSPADLSPVTDSRPVVWTIAGSDSGGGAGIQADLHTLH
FT                   DLGVHGCSVISAITAQNSVAVKMVDPVLMQTFTAQIDALGLDLPPAAIKVGLLPTRLHV
FT                   EVLARRLPTVDAPFVVYDPVAIASTGTPMAEPNMLEAVREQLLPRLSLITPNGPELEAL
FT                   TGLPATSPELVRLAARRLRELGARAVLVKGGHLAWSGDLCLDYYQDETREFWLTAPRLD
FT                   TRHGHGTGCCYASAIAAVVAQDYPVEDAITLARAYLQQGLAAAQGVGAGPGPIAHLGWP
FT                   ADLAHFPRAVLAGSALDRRFGLYETSSARLPQGPFAPTEHNLGLYPVVDSVKWLKRLLG
FT                   AGVKTIQLRIKDLPAAQVAPAIRDAVALGRRHGARLFINDYWQQAIEAGAWGVHLGQED
FT                   METADLAAIQAAGLRLGISTHGYFELMRARELAPSYIALGHIFPTNTKAMPSRPQGLKR
FT                   LHRYRALMCDWPTVAIGGISEERVAAVKESGVGSIALVSAITASDDWQGATERLLAAVG
FT                   AGDEPRSALLMTDMQEAAHAL"
     MSSASGAVSP ADLSPVTDSR PVVWTIAGSD SGGGAGIQAD LHTLHDLGVH GCSVISAITA        60
     QNSVAVKMVD PVLMQTFTAQ IDALGLDLPP AAIKVGLLPT RLHVEVLARR LPTVDAPFVV       120
     YDPVAIASTG TPMAEPNMLE AVREQLLPRL SLITPNGPEL EALTGLPATS PELVRLAARR       180
     LRELGARAVL VKGGHLAWSG DLCLDYYQDE TREFWLTAPR LDTRHGHGTG CCYASAIAAV       240
     VAQDYPVEDA ITLARAYLQQ GLAAAQGVGA GPGPIAHLGW PADLAHFPRA VLAGSALDRR       300
     FGLYETSSAR LPQGPFAPTE HNLGLYPVVD SVKWLKRLLG AGVKTIQLRI KDLPAAQVAP       360
     AIRDAVALGR RHGARLFIND YWQQAIEAGA WGVHLGQEDM ETADLAAIQA AGLRLGISTH       420
     GYFELMRARE LAPSYIALGH IFPTNTKAMP SRPQGLKRLH RYRALMCDWP TVAIGGISEE       480
     RVAAVKESGV GSIALVSAIT ASDDWQGATE RLLAAVGAGD EPRSALLMTD MQEAAHAL         538
//

If you have problems or comments...

PBIL Back to PBIL home page